@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu32550: (2016-07-24 )
MASLTFEHVKKSYHSQLTVKDFDLDVKDKELLVLVGPSGCGKSTTLRMVAGLESISEGNLLIDGERVNDLPPKERDIAMVFQNYALYPHMTVFDNMAFGLKLRKMAKQEIAERVHAAARILEIEHLLKRKPKALSGGQRQRVALGRSIVREPKVFLMDEPLSNLDAKLRVTMRTEISKLHQRLEATIIYVTHDQTEAMTMGDRIVVMNEGEIQQVAKPHDIYHYPANLFVAGFIGSPGMNFLKGIIEQQHGELFFTNSSIRLHIPEEKAKRLKEKGYAGEQMIAGVRPEHITQMTGNDQLFDSVFQANVEVNENLGSELIVHVMAGDERLKVRLDGNTRIDAGDSIQLSVKMDHVVFFDAETEEAVY

Atome Classification :

(46 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_J_5(3C41)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




ADP_A_2(3NHB)

[Raw transfer]




ADP_A_3(3NHA)

[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ATP_A_2(3NH9)

[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




IPA_A_6(3TIF)
Y796_METJA
[Raw transfer]




6 PsiBlast_PDB 84.1848%-104 - C1 -1V43 - ? -
3 PsiBlast_PDB 83.1251% -78 - C1 -4XIG - ? -
119 HHSearch 83.0742%-115 - C1 -2IT1 - ? -
5 PsiBlast_PDB 82.8948%-101 - C1 -1VCI - ? -
1 PsiBlast_PDB 82.8551% -73 - C1 -4TQU - ? -
4 PsiBlast_PDB 82.3951% -79 - C1 -4XTC - ? -
117 HHSearch 82.0750% -88 - C1 -4TQU - ? -
123 HHSearch 82.0448% -80 - C1 -3RLF - MALK_ECOLI -
2 PsiBlast_PDB 81.3451% -76 - C1 -4TQV - ? -
36 PsiBlast_CBE 81.2041% -93 - C1 -2IT1 - ? -
118 HHSearch 78.0349% -84 - C1 -1V43 - ? -
7 PsiBlast_PDB 77.5747% 15 - C1 -2D62 - ? -
120 HHSearch 77.1444% -73 - C1 -2YYZ - ? -
19 PsiBlast_PDB 76.5052%-107 - C1 -3RLF - MALK_ECOLI -
18 PsiBlast_PDB 75.8252%-104 - C1 -3PUX - MALK_ECOLI -
16 PsiBlast_PDB 75.1952%-105 - C1 -3PUV - MALK_ECOLI -
35 PsiBlast_CBE 74.9343% -68 - C1 -2YYZ - ? -
23 PsiBlast_CBE 74.3352%-104 - C1 -3RLF - MALK_ECOLI -
13 PsiBlast_PDB 74.2852%-103 - C1 -3PUY - MALK_ECOLI -
22 PsiBlast_CBE 74.2252%-104 - C1 -4KI0 - MALK_ECOLI -
124 HHSearch 50.8331% -10 - C1 -3FVQ 8.2 FBPC_NEIG1
50 PsiBlast_CBE 46.2037% -16 - C1 -3FVQ 7.3 FBPC_NEIG1
49 PsiBlast_CBE 44.5137% -17 - C1 -3FVQ 7.7 FBPC_NEIG1
72 PsiBlast_CBE 40.3735% -34 - C1 -4YMV 5.0 ?
74 PsiBlast_CBE 40.3235% -37 - C1 -4YMU 5.8 ?
71 PsiBlast_CBE 40.1735% -37 - C1 -4YMV 5.1 ?
73 PsiBlast_CBE 40.0735% -35 - C1 -4YMU 6.1 ?
79 PsiBlast_CBE 39.8533% -25 - C1 -4U00 6.3 ?
132 HHSearch 34.5230% 40 - C1 -4MKI 2.2 ECFA2_CALS4
82 PsiBlast_CBE 34.3932% 36 - C1 -3TIF 3.3 Y796_METJA
68 PsiBlast_CBE 34.0136% -17 - C1 -2OLK 6.3 ?
57 PsiBlast_CBE 33.7236% -10 - C1 -3C4J 5.8 ?
55 PsiBlast_CBE 33.6636% -18 - C1 -3C41 5.9 ?
66 PsiBlast_CBE 33.5036% -17 - C1 -2OLK 7.0 ?
80 PsiBlast_CBE 33.1532% 31 - C1 -1L2T 6.5 Y796_METJA
67 PsiBlast_CBE 32.9136% -12 - C1 -2OLK 7.0 ?
70 PsiBlast_CBE 32.5736% -10 - C1 -2OLJ 6.5 ?
60 PsiBlast_CBE 32.4536% -13 - C1 -2Q0H 5.9 ?
65 PsiBlast_CBE 32.2636% -13 - C1 -2OLK 6.9 ?
69 PsiBlast_CBE 32.2536% -6 - C1 -2OLJ 6.6 ?
59 PsiBlast_CBE 31.4936% -18 - C1 -2Q0H 6.2 ?
58 PsiBlast_CBE 31.4436% -12 - C1 -3C4J 6.8 ?
56 PsiBlast_CBE 30.0736% -16 - C1 -3C41 7.5 ?
91 PsiBlast_CBE 26.3731% -5 - C1 -3NH9 6.4
89 PsiBlast_CBE 26.0731% -1 - C1 -3NHB 6.4
90 PsiBlast_CBE 25.2831% -1 - C1 -3NHA 6.1