@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu32900: (2016-07-25 )
MKGMFFCARAVVPFMKKSKDGAIVNVGSIAGITGAGSSMPYAVSKSAVHGLTKSLAHALAPEIRVSGVAPGAVATRWWAGREEKMKSMIGSLLLQCIAEPDDVAKLICSLIEQESLTGQIITIDSGQTL

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_A_3(4QED)
?
[Raw transfer]




NAD_A_5(4FN4)
?
[Raw transfer]




86 PsiBlast_CBE 91.3234% 0 - C- -1GEG - BUDC_KLEPN -
85 PsiBlast_CBE 91.3234% 0 - C- -1GEG - BUDC_KLEPN -
84 PsiBlast_CBE 91.3234% 0 - C- -1GEG - BUDC_KLEPN -
83 PsiBlast_CBE 91.3234% 0 - C- -1GEG - BUDC_KLEPN -
82 PsiBlast_CBE 91.3234% 0 - C- -1GEG - BUDC_KLEPN -
81 PsiBlast_CBE 91.3234% 0 - C- -1GEG - BUDC_KLEPN -
80 PsiBlast_CBE 91.3234% 0 - C- -1GEG - BUDC_KLEPN -
79 PsiBlast_CBE 91.3234% 0 - C- -1GEG - BUDC_KLEPN -
22 PsiBlast_CBE 79.9735% -51 - C5 -4JRO - ? -
89 PsiBlast_CBE 78.1931% -80 - C5 -2DTE - ? -
5 PsiBlast_PDB 77.7338% -31 - C5 -3O4R - DHRS4_HUMAN -
91 PsiBlast_CBE 77.1431% -79 - C5 -2DTD - ? -
90 PsiBlast_CBE 77.0731% -75 - C5 -2DTE - ? -
13 PsiBlast_PDB 76.7433% - - C5 -2CDH - FABG1_BRANA -
127 HHSearch 76.5924%-121 - C5 -3GED - ? -
88 PsiBlast_CBE 76.5531% -76 - C5 -2DTX - ? -
92 PsiBlast_CBE 76.0231% -78 - C5 -2DTD - ? -
3 PsiBlast_PDB 75.5733% -59 - C5 -2UVD - ? -
44 PsiBlast_CBE 75.3935% -69 - C5 -4QEC - ? -
1 PsiBlast_PDB 75.3335% -45 - C5 -4JRO - ? -
118 HHSearch 71.5934% -54 - C5 -4QED 3.3 ?
126 HHSearch 69.8838% -63 - C5 -4FN4 5.0 ?