@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu32910: (2016-07-25 )
MNVLNKIALVTGGGTGIGKAASMELAKRGAIVAVNYSRSQSEAEETVEMIQKAGGQAFAIQADVSKNSDVQDMIQAIVNTHGTVDILVNNASITRHIPMDDLEAATEDV

Atome Classification :

(40 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEG_A_3(3OSU)
FABG_STAAM
[Raw transfer]




NDP_A_3(3SJ7)
?
[Raw transfer]




NDP_B_6(3SJ7)
?
[Raw transfer]




NAP_B_5(4JRO)
?
[Raw transfer]




NAP_B_6(4DMM)
?
[Raw transfer]




NDP_B_8(3OID)
FABL_BACSU
[Raw transfer]




NAD_K_11(1GEE)
DHG_BACME
[Raw transfer]




NDP_D_12(3OID)
FABL_BACSU
[Raw transfer]




NAP_C_8(4IQG)
?
[Raw transfer]




NAD_O_15(1GCO)
DHG_BACME
[Raw transfer]




NAP_E_5(1EDO)
FABG1_BRANA
[Raw transfer]




NDP_C_10(3OID)
FABL_BACSU
[Raw transfer]




NAD_M_13(1GCO)
DHG_BACME
[Raw transfer]




NAI_C_11(3AY6)
DHG4_BACME
[Raw transfer]




NDP_A_6(3OID)
FABL_BACSU
[Raw transfer]




NAD_L_12(1GEE)
DHG_BACME
[Raw transfer]




NAD_M_13(1RWB)
DHG_BACME
[Raw transfer]




NAP_C_7(4DMM)
?
[Raw transfer]




NAD_J_10(1GEE)
DHG_BACME
[Raw transfer]




NAP_D_7(4JRO)
?
[Raw transfer]




NAP_C_6(4JRO)
?
[Raw transfer]




NAI_D_14(3AY6)
DHG4_BACME
[Raw transfer]




NAD_L_12(1G6K)
DHG_BACME
[Raw transfer]




NAD_K_11(1G6K)
DHG_BACME
[Raw transfer]




NAI_A_5(3AY6)
DHG4_BACME
[Raw transfer]




NAD_K_11(1GCO)
DHG_BACME
[Raw transfer]




NAP_D_8(4DMM)
?
[Raw transfer]




NAI_B_9(3AY6)
DHG4_BACME
[Raw transfer]




NAD_K_11(1RWB)
DHG_BACME
[Raw transfer]




NAI_B_3(3AUT)
DHG4_BACME
[Raw transfer]




NAD_O_15(1RWB)
DHG_BACME
[Raw transfer]




PEG_A_6(3OSU)
FABG_STAAM
[Raw transfer]




THJ_A_4(3GED)
?
[Raw transfer]




63 PsiBlast_CBE 86.2550%-124 - C1 -4DMM 6.9 ?
64 PsiBlast_CBE 85.7850%-113 - C1 -4DMM - ? -
61 PsiBlast_CBE 84.5950%-129 - C1 -4DMM 7.2 ?
62 PsiBlast_CBE 83.7850%-130 - C1 -4DMM 7.7 ?
8 PsiBlast_PDB 80.4347%-104 - C1 -3OSU 2.3 FABG_STAAM
1 PsiBlast_PDB 80.3348%-109 - C1 -2UVD - ? -
49 PsiBlast_CBE 78.9542%-100 - C1 -4JRO 7.0 ?
2 PsiBlast_PDB 78.1041%-100 - C1 -1EDO 7.9 FABG1_BRANA
50 PsiBlast_CBE 78.0942%-101 - C1 -4JRO 7.2 ?
48 PsiBlast_CBE 77.5742%-100 - C1 -4JRO 6.5 ?
72 PsiBlast_CBE 77.3138%-139 - C1 -4K6C - ? -
70 PsiBlast_CBE 77.2638%-140 - C1 -4K6F - ? -
67 PsiBlast_CBE 76.9842% -76 - C1 -3ICC - ? -
23 PsiBlast_CBE 76.1940%-106 - C1 -3OID 6.9 FABL_BACSU
7 PsiBlast_PDB 76.0342%-118 - C1 -4MOW - ? -
6 PsiBlast_PDB 75.9240%-105 - C1 -3OID 6.7 FABL_BACSU
24 PsiBlast_CBE 75.6240%-103 - C1 -3OID 7.2 FABL_BACSU
71 PsiBlast_CBE 75.4638%-135 - C1 -4K6C - ? -
69 PsiBlast_CBE 75.4338%-131 - C1 -4K6F - ? -
68 PsiBlast_CBE 75.4238%-134 - C1 -4K6F - ? -
21 PsiBlast_CBE 75.3847% -90 - C1 -3SJ7 7.0 ?
22 PsiBlast_CBE 75.2640%-103 - C1 -3OID 7.0 FABL_BACSU
4 PsiBlast_PDB 73.0047% -86 - C1 -3SJ7 6.7 ?
45 PsiBlast_CBE 72.2337%-100 - C1 -1GCO 6.0 DHG_BACME
42 PsiBlast_CBE 71.8337% -99 - C1 -1GEE 6.1 DHG_BACME
35 PsiBlast_CBE 71.2835%-102 - C1 -1G6K 5.5 DHG_BACME
44 PsiBlast_CBE 70.9937% -98 - C1 -1GCO 6.0 DHG_BACME
36 PsiBlast_CBE 70.8535%-106 - C1 -1G6K 5.3 DHG_BACME
15 PsiBlast_PDB 70.6943%-109 - C1 -4IQG 6.5 ?
46 PsiBlast_CBE 70.6437% -92 - C1 -1GCO 5.8 DHG_BACME
41 PsiBlast_CBE 70.5537% -97 - C1 -1GEE 5.7 DHG_BACME
39 PsiBlast_CBE 70.3237% -96 - C1 -1RWB 4.6 DHG_BACME
40 PsiBlast_CBE 69.5937% -92 - C1 -1RWB 5.0 DHG_BACME
38 PsiBlast_CBE 69.4537% -96 - C1 -1RWB 5.2 DHG_BACME
43 PsiBlast_CBE 69.3837% -90 - C1 -1GEE 5.8 DHG_BACME
31 PsiBlast_CBE 67.1034% -92 - C1 -3AY6 5.3 DHG4_BACME
32 PsiBlast_CBE 67.0834% -86 - C1 -3AY6 5.2 DHG4_BACME
10 PsiBlast_PDB 66.5434% -94 - C1 -3AY6 5.6 DHG4_BACME
34 PsiBlast_CBE 65.0634% -90 - C1 -3AUT 5.7 DHG4_BACME
30 PsiBlast_CBE 63.9034% -82 - C1 -3AY6 5.6 DHG4_BACME