@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu33270: (2016-07-25 )
MLTLNNISKSYKLGKEEVPILKHINLTVQAGEFLAIMGPSGSGKSTLMNIIGCLDRPTSGTYTLDQIDILKGKDGALAEIRNESIGFVFQTFHLLPRLTALQNVELPMIYNKVKKKERRQRAYEALEKVGLKDRVSYKPPKLSGGQKQRVAIARALVNQPRFILADEPTGALDTKSSEQILALFSELHREGKTIIMITHDPDVAKKADRTVFIRDGELVLDERGDISHA

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_E_5(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_E_5(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_G_7(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_F_6(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_F_6(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_H_8(2FGK)

[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




12D_A_2(3B5J)

[Raw transfer]




ADP_B_2(2FFB)

[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




ATP_G_7(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ADP_B_2(2FF7)

[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




3 PsiBlast_PDB 83.5951% -1 - C1 -1F3O - Y796_METJA -
21 PsiBlast_CBE 82.8351% -5 - C1 -1L2T - Y796_METJA -
1 PsiBlast_PDB 82.4451% -2 - C1 -1L2T - Y796_METJA -
22 PsiBlast_CBE 81.8050% -5 - C1 -3TIF - Y796_METJA -
2 PsiBlast_PDB 80.8650% -3 - C1 -3TIF - Y796_METJA -
13 PsiBlast_PDB 79.2940%-132 - C1 -3TUZ - METN_ECOLI -
25 PsiBlast_CBE 77.9443% -78 - C1 -4YMU - ? -
10 PsiBlast_PDB 77.8943% -75 - C1 -4YMW - ? -
118 HHSearch 77.2940%-119 - C1 -3TUI - METN_ECOLI -
6 PsiBlast_PDB 76.9243% -74 - C1 -4YMS - ? -
12 PsiBlast_PDB 76.8140%-125 - C1 -3TUI - METN_ECOLI -
8 PsiBlast_PDB 76.7243% -73 - C1 -4YMU - ? -
24 PsiBlast_CBE 76.6243% -81 - C1 -4YMV - ? -
9 PsiBlast_PDB 75.8143% -79 - C1 -4YMV - ? -
7 PsiBlast_PDB 75.5443% -72 - C1 -4YMT - ? -
30 PsiBlast_CBE 75.5140%-119 - C1 -3TUI - METN_ECOLI -
29 PsiBlast_CBE 75.2840%-129 - C1 -3TUI - METN_ECOLI -
26 PsiBlast_CBE 75.0840%-128 - C1 -3TUZ - METN_ECOLI -
27 PsiBlast_CBE 74.5440%-126 - C1 -3TUZ - METN_ECOLI -
4 PsiBlast_PDB 74.3845%-115 - C1 -2PCJ - LOLD_AQUAE -
103 PsiBlast_CBE 57.6435% -34 - C1 -2FGJ 7.0 HLYBP_ECOLX
83 PsiBlast_CBE 57.4337% 12 - C1 -1B0U 4.3 HISP_SALTY
100 PsiBlast_CBE 56.2935% -33 - C1 -2FGJ 7.0
95 PsiBlast_CBE 55.4035% -29 - C1 -2FGK 7.3
90 PsiBlast_CBE 54.6335% -37 - C1 -2FF7 6.5
99 PsiBlast_CBE 54.0635% -44 - C1 -2FFB 6.3
87 PsiBlast_CBE 53.8135% 47 - C1 -4MKI 2.0 ECFA2_CALS4
94 PsiBlast_CBE 53.4135% -43 - C1 -3B5J 6.9
86 PsiBlast_CBE 53.0935% 42 - C1 -4MKI 2.2 ECFA2_CALS4
101 PsiBlast_CBE 52.1535% -26 - C1 -2FGJ 7.1 HLYBP_ECOLX
92 PsiBlast_CBE 51.2235% -38 - C1 -2PMK 6.8
102 PsiBlast_CBE 51.2135% -30 - C1 -2FGJ 7.4 HLYBP_ECOLX
97 PsiBlast_CBE 50.7635% -33 - C1 -2FGK 7.3 HLYBP_ECOLX
96 PsiBlast_CBE 49.6335% -29 - C1 -2FGK 6.7 HLYBP_ECOLX
98 PsiBlast_CBE 49.1135% -30 - C1 -2FGK 7.7 HLYBP_ECOLX
85 PsiBlast_CBE 43.8336% -6 - C1 -1VCI 4.0 ?