@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu33910: (2016-07-27 )
MSKKPAALIILDGFGLRNETVGNAVALAKKPNFDRYWNQYPHQTLTASGEAVGLPEGQMGNSEVGHLNIGAGRIVYQSLTRVNVAIREGEFERNQTFLDAISNAKENNKALHLFGLLSDGGVHSHINHLFALLKLAKKEGLTKVYIHGFLDGRDVGPQTAKTYINQLNDQIKEIGVGEIASISGRYYSMDRDKRWDRVEKAYRAMAYGEGPSYRSALDVVDDSYANGIYDEFVIPSVITKENGEPVAKIQDGDSVIFYNFRPDRAIQISNTFTNKDFRDFDRGENYPKNLYFVCLTHFSETVDGYVAFKPINLDNTVGEVLSQHGLKQLRIAETEKYPHVTFFMSGGREAEFPGEERILINSPKVATYDLKPEMSAYEVKDALVKEIEADKHDAIILNFANPDMVGHSGMVEPTIKAIEAVDECLGEVVDAILAKGGHAIITADHGNADILITESGEPHTAHTTNPVPVIVTKEGITLREGGILGDLAPTLLDLLGVEKPKEMTGTSLIQK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2PG_A_3(1O99)
GPMI_GEOSE
[Raw transfer]




2PG_A_4(1O98)
GPMI_GEOSE
[Raw transfer]




3PG_A_4(1EJJ)
GPMI_GEOSE
[Raw transfer]




2PG_A_4(1EQJ)
GPMI_GEOSE
[Raw transfer]




2PG_A_4(1O98)
GPMI_GEOSE
[Raw transfer]




3PG_B_5(3IGY)
?
[Raw transfer]




2PG_A_4(4QAX)
?
[Raw transfer]




2PG_A_2(4NWX)
?
[Raw transfer]




3PG_A_4(4NWJ)
?
[Raw transfer]




45 Fugue 97.2580% -83 - C4 -1EJJ - GPMI_GEOSE -
3 PsiBlast_PDB 96.1080% -81 - C4 -1O98 6.2 GPMI_GEOSE
1 PsiBlast_PDB 95.6480% -83 - C4 -1EJJ 6.4 GPMI_GEOSE
4 PsiBlast_PDB 95.5880% -80 - C4 -1O99 6.6 GPMI_GEOSE
2 PsiBlast_PDB 95.5080% -81 - C4 -1EQJ 5.7 GPMI_GEOSE
5 PsiBlast_PDB 93.6578% -91 - C4 -2IFY - GPMI_BACAN -
23 HHSearch 86.0181% -43 - C4 -1O98 6.2 GPMI_GEOSE
22 HHSearch 85.1563% -83 - C4 -4MY4 - ? -
8 PsiBlast_PDB 84.5262% -83 - C4 -4NWX 4.1 ?
9 PsiBlast_PDB 84.2362% -81 - C4 -4QAX 3.2 ?
6 PsiBlast_PDB 84.1062% -82 - C4 -4MY4 - ? -
7 PsiBlast_PDB 83.9462% -82 - C4 -4NWJ 4.1 ?
24 HHSearch 55.2532% 36 - C4 -3IGZ - ? -
11 PsiBlast_PDB 54.7331% 36 - C4 -3IGY 6.1 ?
21 PsiBlast_CBE 54.5033% 31 - C4 -3NVL - ? -
12 PsiBlast_PDB 54.4631% 34 - C4 -3IGZ - ? -
10 PsiBlast_PDB 53.9233% 28 - C4 -3NVL - ? -
44 HHSearch 29.6127% -34 - C4 -3OT9 - DEOB_BACCR -
39 HHSearch 28.1519% -8 - C4 -3B5Q - ? -
14 PsiBlast_PDB 27.0529% -47 - C4 -3M8Y - DEOB_BACCR -