@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu34550: (2016-07-28 )
MKAVIFDLDGVITDTAEYHFLAWKHIAEQIDIPFDRDMNERLKGISREESLESILIFGGAETKYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSSRNAPKILRRLAIIDDFHAIVDPTTLAKGKPDPDIFLTAAAMLDVSPADCAAIEDAEAGISAIKSAGMFAVGVGQGQPMLGADLVVRQTSDLTLELLHEEWEQYRIRESIP

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

G16_A_2(1O08)
PGMB_LACLA
[Raw transfer]




G16_A_2(1O03)
PGMB_LACLA
[Raw transfer]




BG6_A_4(2WF6)
PGMB_LACLA
[Raw transfer]




BG6_A_2(2WF5)
PGMB_LACLA
[Raw transfer]




BG6_A_3(3ZI4)
PGMB_LACLA
[Raw transfer]




GL1_A_5(1Z4N)
PGMB_LACLA
[Raw transfer]




G7P_A_4(2WF7)
PGMB_LACLA
[Raw transfer]




GRX_A_2(4C4T)
PGMB_LACLA
[Raw transfer]




G7P_A_4(2WF7)
PGMB_LACLA
[Raw transfer]




GRX_A_2(4C4S)
PGMB_LACLA
[Raw transfer]




GL1_B_6(1Z4N)
PGMB_LACLA
[Raw transfer]




G6P_A_3(2WF9)
PGMB_LACLA
[Raw transfer]




GL1_A_5(1Z4O)
PGMB_LACLA
[Raw transfer]




GL1_B_6(1Z4O)
PGMB_LACLA
[Raw transfer]




G1P_A_4(2WF8)
PGMB_LACLA
[Raw transfer]




YO5_A_3(4C4R)
PGMB_LACLA
[Raw transfer]




MGF_A_4(4C4R)
PGMB_LACLA
[Raw transfer]




42 HHSearch 97.63100%-156 - C1 -3NAS - PGMB_BACSU -
1 PsiBlast_PDB 96.7696%-156 - C1 -3NAS - PGMB_BACSU -
20 PsiBlast_PDB 84.4747%-156 - C1 -4G9B - PGMB_ECOLI -
21 PsiBlast_CBE 80.0747%-114 - C1 -4GIB - ? -
2 PsiBlast_PDB 79.1447%-108 - C1 -4GIB - ? -
43 HHSearch 79.0948%-110 - C1 -4GIB - ? -
7 PsiBlast_PDB 69.7150% -26 - C1 -1ZOL - PGMB_LACLA -
9 PsiBlast_PDB 69.2050% -17 - C1 -2WHE - PGMB_LACLA -
14 PsiBlast_PDB 68.0750% -15 - C1 -2WFA - PGMB_LACLA -
19 PsiBlast_PDB 67.4549% -19 - C1 -3FM9 - PGMB_LACLA -
13 PsiBlast_PDB 67.1550% -10 - C1 -2WF9 4.4 PGMB_LACLA
5 PsiBlast_PDB 65.5450% -13 - C1 -1Z4N 4.9 PGMB_LACLA
8 PsiBlast_PDB 64.6850% -12 - C1 -2WF5 5.6 PGMB_LACLA
15 PsiBlast_PDB 64.5350% -14 - C1 -3ZI4 5.8 PGMB_LACLA
48 HHSearch 64.5245% -45 - C1 -4G9B - PGMB_ECOLI -
18 PsiBlast_PDB 64.2150% -8 - C1 -4C4T 6.9 PGMB_LACLA
4 PsiBlast_PDB 64.1750% -16 - C1 -1O08 6.4 PGMB_LACLA
10 PsiBlast_PDB 64.1350% -11 - C1 -2WF7 5.2 PGMB_LACLA
11 PsiBlast_PDB 64.1150% -13 - C1 -2WF6 5.1 PGMB_LACLA
12 PsiBlast_PDB 64.0250% -10 - C1 -2WF8 4.4 PGMB_LACLA
16 PsiBlast_PDB 63.6750% -11 - C1 -4C4R 6.4 PGMB_LACLA
22 PsiBlast_CBE 63.2150% -16 - C1 -1Z4O 5.2 PGMB_LACLA
3 PsiBlast_PDB 63.0550% -15 - C1 -1O03 6.7 PGMB_LACLA
6 PsiBlast_PDB 62.7950% -8 - C1 -1Z4O 5.3 PGMB_LACLA
17 PsiBlast_PDB 61.8150% -10 - C1 -4C4S 6.5 PGMB_LACLA
41 HHSearch 60.7647% -22 - C1 -2WF7 5.2 PGMB_LACLA
23 PsiBlast_CBE 57.7450% 1 - C1 -1Z4N 5.0 PGMB_LACLA