@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu35260: (2016-07-29 )
MIEMKEVYKAYPNGVKALNGISVTIHPGEFVYVVGPSGAGKSTFIKMIYREEKPTKGQILINHKDLATIKEKEIPFVRRKIGVVFQDFKLLPKLTVFENVAFALEVIGEQPSVIKKRVLEVLDLVQLKHKARQFPDQLSGGEQQRVSIARSIVNNPDVVIADEPTGNLDPDTSWEVMKTLEEINNRGTTVVMATHNKEIVNTMKKRVIAIEDGIIVRDESRGEYGSYD

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




ADP_A_3(1F3O)
Y796_METJA
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




3 PsiBlast_PDB 75.6738% -2 - C1 -3TUZ - METN_ECOLI -
2 PsiBlast_PDB 75.2538% -1 - C1 -3TUI - METN_ECOLI -
105 HHSearch 75.0638% 0 * C1 *3TUI - METN_ECOLI -
69 PsiBlast_CBE 74.0835%-116 - C1 -3PUV - MALK_ECOLI -
25 PsiBlast_CBE 73.5338% -12 - C1 -3TUI - METN_ECOLI -
59 PsiBlast_CBE 73.1835%-120 - C1 -3RLF - MALK_ECOLI -
1 PsiBlast_PDB 72.1638% -2 - C1 -3DHW - METN_ECOLI -
67 PsiBlast_CBE 72.0535%-117 - C1 -3PUW - MALK_ECOLI -
104 HHSearch 71.7633%-115 - C1 -4TQU - ? -
109 HHSearch 71.6135%-103 - C1 -2YYZ - ? -
106 HHSearch 71.5938% -99 - C1 -2IT1 - ? -
24 PsiBlast_CBE 71.5638% -9 - C1 -3TUI - METN_ECOLI -
47 PsiBlast_CBE 71.3638%-109 - C1 -2IT1 - ? -
81 PsiBlast_CBE 70.6035%-115 - C1 -2R6G - MALK_ECOLI (first) -
23 PsiBlast_CBE 70.2238% -3 - C1 -3TUZ - METN_ECOLI -
57 PsiBlast_CBE 69.9535%-119 - C1 -4KI0 - MALK_ECOLI -
112 HHSearch 69.9435%-119 - C1 -3RLF - MALK_ECOLI -
64 PsiBlast_CBE 69.8035%-124 - C1 -3PUY - MALK_ECOLI -
65 PsiBlast_CBE 69.4335%-117 - C1 -3PUX - MALK_ECOLI -
80 PsiBlast_CBE 69.0935%-122 - C1 -2R6G - MALK_ECOLI (first) -
5 PsiBlast_PDB 67.2140% 46 - C1 -1L2T 6.5 Y796_METJA
6 PsiBlast_PDB 65.8739% 44 - C1 -3TIF 6.0 Y796_METJA
31 PsiBlast_CBE 65.6736% -65 - C1 -2Q0H 6.0 ?
27 PsiBlast_CBE 65.2340% 47 - C1 -1L2T 6.7 Y796_METJA
7 PsiBlast_PDB 64.5640% 53 - C1 -1F3O 6.1 Y796_METJA
28 PsiBlast_CBE 63.7939% 47 - C1 -3TIF 6.5 Y796_METJA
10 PsiBlast_PDB 63.0636% -64 - C1 -2OLJ 6.1 ?
40 PsiBlast_CBE 62.6237% -71 - C1 -4YMV 4.8 ?
41 PsiBlast_CBE 62.1037% -70 - C1 -4YMU 5.8 ?
30 PsiBlast_CBE 61.9536% -58 - C1 -3C4J 4.9 ?
37 PsiBlast_CBE 61.9136% -68 - C1 -2OLK 6.2 ?
39 PsiBlast_CBE 61.1536% -65 - C1 -3C41 5.9 ?
36 PsiBlast_CBE 60.7736% -61 - C1 -2OLK 6.2 ?
13 PsiBlast_PDB 60.3436% -54 - C1 -2Q0H 5.6 ?
18 PsiBlast_PDB 60.1837% -65 - C1 -4YMU 5.7 ?
46 PsiBlast_CBE 60.0336% -52 - C1 -4U00 6.2 ?
11 PsiBlast_PDB 59.9436% -64 - C1 -2OLK 6.1 ?
35 PsiBlast_CBE 58.9936% -63 - C1 -2OLK 6.2 ?
14 PsiBlast_PDB 58.6836% -61 - C1 -3C4J 6.6 ?
15 PsiBlast_PDB 58.3036% -54 - C1 -3C41 7.0 ?
38 PsiBlast_CBE 58.1736% -58 - C1 -2OLJ 5.8 ?