@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu35270: (2016-07-29 )
MKSKLSILMIGFALSVLLAACGSNDAKEEKTDTGSKTEATASEGEELYQQSCVGCHGKDLEGVSGPNLQEVGGKYDEHKIESIIKNGRGNMPKGLVDDNEAAVIAKWLSEKK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEM_A_2(1B7V)
CY553_SPOPA
[Raw transfer]




HEM_B_5(3WFD)
NORC_PSEAE
[Raw transfer]




73 Fugue 77.6145% -94 - C1 -1C75 - CY553_SPOPA -
72 Fugue 77.4345%-101 - C1 -1K3G - CY553_SPOPA -
4 PsiBlast_PDB 75.5545% -95 - C1 -1C75 - CY553_SPOPA -
5 PsiBlast_PDB 74.8545%-100 - C1 -1K3G - CY553_SPOPA -
1 PsiBlast_PDB 74.8545% -96 * C1 *1B7V 6.0 CY553_SPOPA
2 PsiBlast_PDB 74.3545% -96 - C1 -1K3H - CY553_SPOPA -
3 PsiBlast_PDB 72.8745% -85 - C1 -1N9C - CY553_SPOPA -
80 HHSearch 69.5645% -58 - C1 -1C75 - CY553_SPOPA -
96 HHSearch 63.4826% -35 - C1 -3CP5 - ? -
22 PsiBlast_CBE 59.9734% 45 - C1 -2EXV - CY551_PSEAE -
75 Fugue 58.7820% 63 - C1 -1NIR - NIRS_PSEAE -
85 HHSearch 58.3930% 58 - C1 -3MK7 - ? -
83 HHSearch 57.9835% 55 - C1 -2EXV - CY551_PSEAE -
74 Fugue 57.1132% -27 - C1 -1DII - CY4C_PSEPU -
98 HHSearch 56.7428% 53 - C1 -3C2C - CYC2_RHORU -
90 HHSearch 56.1523% 46 - C1 -1I8O - CYC22_RHOPA -
23 PsiBlast_CBE 56.0438% 4 - C1 -2D0W - ? -
12 PsiBlast_PDB 55.7738% 6 - C1 -2D0W - ? -
10 PsiBlast_PDB 55.4234% 54 - C1 -2EXV - CY551_PSEAE -
16 PsiBlast_PDB 53.9632% 82 - C1 -2I8F - CY551_PSEST -