@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu35480: (2016-07-30 )
MNIAVVTDSTAYIPKEMREQHQIHMIPLQVVFREETYREEIELDWKSFYEEVKKHNELPTTSQPPIGELVALYEELGKSYDAVISIHLSSGISGTFSSAAAADSMVDNIDVYPFDSEISCLAQGFYALKAAELIKNGASSPEDIIKELEEMKKTVRAYFMVDDLAHLQRGGRLSSAQAFIGSLLKVKPILHFDNKVIVPFEKIRTRKKAISRIYELLDEDASKGLPMRAAVIHANREEEAAKIIEELSAKYPHVEFYNSYFGAVIGTHLGEGALGICWCFK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PLM_A_2(3FYS)
DEGV_BACSU
[Raw transfer]




TRS_A_23(2G7Z)
Y1493_STRP1
[Raw transfer]




PLM_A_2(1MGP)
Y1468_THEMA
[Raw transfer]




GOL_A_24(2G7Z)
Y1493_STRP1
[Raw transfer]




ELA_A_2(3LUP)
?
[Raw transfer]




ELA_A_2(3LUP)
?
[Raw transfer]




1 PsiBlast_PDB 94.33100%-139 - C3 -3FYS - DEGV_BACSU -
29 HHSearch 89.16100% -77 - C3 -3FYS 7.9 DEGV_BACSU
26 HHSearch 71.3532%-108 - C3 -2DT8 - ? -
32 HHSearch 69.0032%-109 - C3 -4X9X - Y1315_STAAW -
4 PsiBlast_PDB 66.4233%-104 - C3 -4X9X - Y1315_STAAW -
28 HHSearch 64.4731% -30 - C3 -3LUP 4.3 ?
30 HHSearch 63.5930% -46 - C3 -1PZX - ? -
33 HHSearch 62.6228% -47 - C3 -2G7Z - Y1493_STRP1 -
7 PsiBlast_PDB 61.5432% -38 - C3 -2DT8 - ? -
5 PsiBlast_PDB 61.3031% -27 - C3 -3LUP 5.6 ?
34 HHSearch 61.2234% 9 - C3 -1MGP 4.9 Y1468_THEMA
6 PsiBlast_PDB 60.7530% -33 - C3 -1PZX - ? -
9 PsiBlast_PDB 60.4328% -42 - C3 -2G7Z 2.3 Y1493_STRP1
2 PsiBlast_PDB 59.9935% 1 - C3 -1VPV - Y1468_THEMA -
3 PsiBlast_PDB 58.9535% 7 - C3 -1MGP - Y1468_THEMA -
8 PsiBlast_PDB 58.1031% -15 - C3 -3PL5 - ? -
36 HHSearch 57.3820% -17 - C3 -3JR7 - ? -
31 HHSearch 56.6620% -23 - C3 -3FDJ - ? -
27 HHSearch 56.4722% 15 - C3 -3NYI - ? -
35 HHSearch 56.3830% 20 * C3 *3PL5 - ? -