@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu35930: (2016-07-30 )
MKKHGILNSHLAKILADLGHTDKIVIADAGLPVPDGVLKIDLSLKPGLPAFQDTAAVLAEEMAVEKVIAAAEIKASNQENAKFLENLFSEQEIEYLSHEEFKLLTKDAKAVIRTGEFTPYANCILQAGVLF

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RIP_C_9(1OGD)
RBSD_BACSU
[Raw transfer]




RIP_E_12(1OGD)
RBSD_BACSU
[Raw transfer]




RIP_D_10(1OGD)
RBSD_BACSU
[Raw transfer]




RP5_A_7(1OGE)
RBSD_BACSU
[Raw transfer]




RP5_D_11(1OGE)
RBSD_BACSU
[Raw transfer]




RP5_E_12(1OGE)
RBSD_BACSU
[Raw transfer]




RIP_A_7(1OGD)
RBSD_BACSU
[Raw transfer]




RIP_B_8(1OGD)
RBSD_BACSU
[Raw transfer]




RIP_A_7(1OGD)
RBSD_BACSU
[Raw transfer]




RIP_A_7(1OGD)
RBSD_BACSU
[Raw transfer]




RP5_C_9(1OGE)
RBSD_BACSU
[Raw transfer]




RP5_B_8(1OGE)
RBSD_BACSU
[Raw transfer]




GOL_B_9(1OGF)
RBSD_BACSU
[Raw transfer]




GOL_B_8(1OGF)
RBSD_BACSU
[Raw transfer]




GOL_D_11(1OGF)
RBSD_BACSU
[Raw transfer]




GOL_D_10(1OGF)
RBSD_BACSU
[Raw transfer]




GOL_A_6(1OGF)
RBSD_BACSU
[Raw transfer]




RIP_D_8(3P13)
RBSD_STAA8
[Raw transfer]




RIP_A_5(3P13)
RBSD_STAA8
[Raw transfer]




RIP_C_7(3P13)
RBSD_STAA8
[Raw transfer]




RIP_B_6(3P13)
RBSD_STAA8
[Raw transfer]




GOL_D_8(3P12)
RBSD_STAA8
[Raw transfer]




GOL_B_6(3P12)
RBSD_STAA8
[Raw transfer]




GOL_C_7(3P12)
RBSD_STAA8
[Raw transfer]




GOL_A_5(3P12)
RBSD_STAA8
[Raw transfer]




GOL_A_5(3P12)
RBSD_STAA8
[Raw transfer]




17 PsiBlast_CBE 78.63100%-116 - C3 -1OGF 2.7 RBSD_BACSU
21 PsiBlast_CBE 78.60100%-115 - C3 -1OGE 2.7 RBSD_BACSU
28 PsiBlast_CBE 78.43100%-118 - C3 -1OGC - RBSD_BACSU -
26 PsiBlast_CBE 78.30100%-115 - C3 -1OGD 3.2 RBSD_BACSU
25 PsiBlast_CBE 77.75100%-109 - C3 -1OGD 3.2 RBSD_BACSU
24 PsiBlast_CBE 77.66100%-114 - C3 -1OGD 3.2 RBSD_BACSU
1 PsiBlast_PDB 77.59100%-115 - C3 -1OGC - RBSD_BACSU -
3 PsiBlast_PDB 77.57100%-118 - C3 -1OGE 2.7 RBSD_BACSU
18 PsiBlast_CBE 77.53100%-120 - C3 -1OGF 2.7 RBSD_BACSU
22 PsiBlast_CBE 77.49100%-115 - C3 -1OGE 2.8 RBSD_BACSU
16 PsiBlast_CBE 77.45100%-120 - C3 -1OGF 4.0 RBSD_BACSU
4 PsiBlast_PDB 77.40100%-117 - C3 -1OGF 2.8 RBSD_BACSU
51 HHSearch 77.36100%-114 - C3 -1OGD 3.2 RBSD_BACSU
43 Fugue 77.36100%-114 - C3 -1OGD 3.2 RBSD_BACSU
19 PsiBlast_CBE 77.36100%-122 - C3 -1OGF 2.6 RBSD_BACSU
2 PsiBlast_PDB 77.36100%-114 - C3 -1OGD 3.2 RBSD_BACSU
27 PsiBlast_CBE 77.32100%-112 - C3 -1OGD 3.3 RBSD_BACSU
20 PsiBlast_CBE 77.28100%-117 - C3 -1OGE 2.9 RBSD_BACSU
23 PsiBlast_CBE 76.96100%-111 - C3 -1OGE 2.8 RBSD_BACSU
5 PsiBlast_PDB 58.0843%-132 - C3 -3E7N - RBSD_SALTY -
53 HHSearch 54.9343% -77 * C3 *3P12 2.8 RBSD_STAA8
6 PsiBlast_PDB 53.6840% -81 - C3 -3P12 2.8 RBSD_STAA8
33 PsiBlast_CBE 53.4640% -82 - C3 -3P12 2.3 RBSD_STAA8
34 PsiBlast_CBE 53.1440% -79 - C3 -3P12 2.7 RBSD_STAA8
32 PsiBlast_CBE 52.8240% -78 - C3 -3P12 2.4 RBSD_STAA8
7 PsiBlast_PDB 52.6640% -73 - C3 -3P13 3.3 RBSD_STAA8
31 PsiBlast_CBE 52.6540% -71 - C3 -3P13 3.3 RBSD_STAA8
30 PsiBlast_CBE 52.3440% -74 - C3 -3P13 3.3 RBSD_STAA8
29 PsiBlast_CBE 51.8640% -71 - C3 -3P13 3.4 RBSD_STAA8