@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu35990: (2016-07-31 )
MKILVLAVHPHMETSVVNKAWAEELSKHDNITVRDLYKEYPDEAIDVAKEQQLCEEYDRIVFQFPLYWYSSPPLLKKWQDLVLTYGWAFGSEGNALHGKELMLAVSTGSEAEKYQAGGANHYSISELLKPFQATSNLIGMKYLPPYVFYGVNYAAAEDISHSAKRLAEYIQQPFV

Atome Classification :

(45 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_B_7(1ZX1)
NQO2_HUMAN
[Raw transfer]




FAD_A_4(3NHY)
NQO2_HUMAN
[Raw transfer]




FAD_A_4(3NHU)
NQO2_HUMAN
[Raw transfer]




MXX_A_3(3GAM)
NQO2_HUMAN
[Raw transfer]




FAD_A_7(3G5M)
NQO2_HUMAN
[Raw transfer]




STL_A_4(4QOJ)
NQO2_HUMAN
[Raw transfer]




RZW_A_5(3NHR)
NQO2_HUMAN
[Raw transfer]




695_B_7(3OX1)
NQO2_HUMAN
[Raw transfer]




4X4_B_8(3OX3)
NQO2_HUMAN
[Raw transfer]




XRA_A_5(3OWX)
NQO2_HUMAN
[Raw transfer]




A7B_A_5(3NHY)
NQO2_HUMAN
[Raw transfer]




ZXZ_A_5(3NHW)
NQO2_HUMAN
[Raw transfer]




GOL_A_6(4QOD)
NQO2_HUMAN
[Raw transfer]




FAD_A_4(3NHS)
NQO2_HUMAN
[Raw transfer]




YTR_B_8(3NHL)
NQO2_HUMAN
[Raw transfer]




FAD_A_5(3OVM)
NQO2_HUMAN
[Raw transfer]




GOL_B_8(4QOD)
NQO2_HUMAN
[Raw transfer]




STL_A_4(4QOH)
NQO2_HUMAN
[Raw transfer]




79X_B_8(3OX2)
NQO2_HUMAN
[Raw transfer]




GOL_A_3(4QOE)
NQO2_HUMAN
[Raw transfer]




372_B_9(4GR9)
NQO2_HUMAN
[Raw transfer]




AO_B_8(4ZVN)
?
[Raw transfer]




K17_A_5(4U7G)
NQO2_HUMAN
[Raw transfer]




K25_B_5(4U7F)
NQO2_HUMAN
[Raw transfer]




FAD_A_4(4FGJ)
NQO2_HUMAN
[Raw transfer]




FMN_B_6(4QOI)
NQO2_HUMAN
[Raw transfer]




FMN_B_5(4QOF)
NQO2_HUMAN
[Raw transfer]




119 HHSearch 91.7836%-165 - C1 -3L9W - KEFC_ECOLI (first) -
3 PsiBlast_PDB 90.7638%-170 - C1 -3L9W - KEFC_ECOLI (first) -
22 PsiBlast_CBE 88.9038%-171 - C1 -3L9W - KEFC_ECOLI -
21 PsiBlast_CBE 88.7938%-172 - C1 -3L9X - KEFC_ECOLI -
4 PsiBlast_PDB 88.4238%-168 - C1 -3L9X - KEFC_ECOLI (first) -
23 PsiBlast_CBE 87.3138%-171 - C1 -3EYW - KEFC_ECOLI -
2 PsiBlast_PDB 86.2538%-169 - C1 -3EYW - KEFC_ECOLI (first) -
111 HHSearch 78.8043% -37 - C1 -3F2V - ? -
1 PsiBlast_PDB 78.5944% -37 - C1 -3F2V - ? -
115 HHSearch 76.8739% -90 - C1 -3HA2 - ? -
5 PsiBlast_PDB 70.7339%-153 - C1 -3HA2 - ? -
101 Fugue 70.1135% -23 - C1 -3EYW - KEFC_ECOLI (first) -
121 HHSearch 65.8731% -14 - C1 -4GI5 - ? -
120 HHSearch 62.1134% 6 - C1 -4FGL - NQO2_HUMAN -
28 PsiBlast_CBE 52.5940% -64 - C1 -4XDG - NQO2_HUMAN -
50 PsiBlast_CBE 52.4540% -60 - C1 -4FGL - NQO2_HUMAN -
17 PsiBlast_PDB 52.0240% -56 - C1 -4QOD - NQO2_HUMAN -
81 PsiBlast_CBE 51.9340% -62 - C1 -3UXE - NQO2_HUMAN -
35 PsiBlast_CBE 51.0940% -57 - C1 -4QOG - NQO2_HUMAN -
27 PsiBlast_CBE 51.0240% -59 - C1 -4XDG - NQO2_HUMAN -
29 PsiBlast_CBE 50.1340% -63 - C1 -4QOJ 4.6 NQO2_HUMAN
37 PsiBlast_CBE 50.1240% -59 - C1 -4QOE 2.6 NQO2_HUMAN
11 PsiBlast_PDB 50.0140% -57 - C1 -3OVM 6.4 NQO2_HUMAN
33 PsiBlast_CBE 49.9340% -61 - C1 -4QOH 3.9 NQO2_HUMAN
32 PsiBlast_CBE 49.4040% -61 - C1 -4QOI 2.7 NQO2_HUMAN
38 PsiBlast_CBE 49.0440% -59 - C1 -4QOD 3.1 NQO2_HUMAN
75 PsiBlast_CBE 48.4840% -52 - C1 -4GR9 2.1 NQO2_HUMAN
62 PsiBlast_CBE 48.4540% -62 - C1 -4ZVN 2.7 ?
48 PsiBlast_CBE 48.2040% -57 - C1 -1ZX1 6.5 NQO2_HUMAN
19 PsiBlast_PDB 47.9440% -59 - C1 -4QOF 2.7 NQO2_HUMAN
13 PsiBlast_PDB 47.8440% -56 - C1 -3OWX 4.0 NQO2_HUMAN
10 PsiBlast_PDB 47.7140% -63 - C1 -3GAM 2.3 NQO2_HUMAN
55 PsiBlast_CBE 47.6740% -53 - C1 -4FGJ 2.3 NQO2_HUMAN
85 PsiBlast_CBE 47.3240% -56 - C1 -3NHY 7.2 NQO2_HUMAN
93 PsiBlast_CBE 47.0940% -54 - C1 -3NHR 2.9 NQO2_HUMAN
91 PsiBlast_CBE 47.0840% -58 - C1 -3NHS 7.7 NQO2_HUMAN
73 PsiBlast_CBE 46.9840% -53 - C1 -4U7F 4.9 NQO2_HUMAN
71 PsiBlast_CBE 46.7540% -55 - C1 -4U7G 3.2 NQO2_HUMAN
9 PsiBlast_PDB 46.6440% -61 - C1 -3G5M 7.9 NQO2_HUMAN
87 PsiBlast_CBE 46.5440% -57 - C1 -3NHW 2.8 NQO2_HUMAN
16 PsiBlast_PDB 46.4540% -61 - C1 -3OX3 2.1 NQO2_HUMAN
89 PsiBlast_CBE 45.7240% -58 - C1 -3NHU 7.3 NQO2_HUMAN
14 PsiBlast_PDB 45.5940% -61 - C1 -3OX1 2.9 NQO2_HUMAN
97 PsiBlast_CBE 45.2040% -59 - C1 -3NHL 3.3 NQO2_HUMAN
15 PsiBlast_PDB 44.7740% -51 - C1 -3OX2 3.6 NQO2_HUMAN