@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu36310: (2016-07-31 )
MFNQVMLVGRLTKDPDLRYTSAGAAVAHVTLAVNRSFKNASGEIEADYVNCTLWRKTAENTALYCQKGSLVGVSGRIQTRSYENEEGVNVYVTEVLADTVRFMDPKPREKAAD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_F_6(3VDY)
SSBB_BACSU
[Raw transfer]

-

NACID_F_6(3VDY)
SSBB_BACSU
[Raw transfer]

-

NACID_G_7(3VDY)
SSBB_BACSU
[Raw transfer]

-

41 HHSearch 89.20100%-124 - C2 -3VDY 6.8 SSBB_BACSU
1 PsiBlast_PDB 89.20100%-124 - C2 -3VDY 6.8 SSBB_BACSU
21 PsiBlast_CBE 86.32100%-114 - C2 -3VDY 4.1 SSBB_BACSU
56 HHSearch 70.2336%-130 - C2 -3EIV - SSB2_STRCO -
3 PsiBlast_PDB 65.3045% -58 - C2 -1X3F - SSB_MYCS2 -
19 PsiBlast_PDB 63.3833% -67 - C2 -1SE8 - SSB_DEIRA -
34 Fugue 62.9921%-161 - C2 -4GS3 - ? -
58 HHSearch 62.9222%-164 - C2 -4GS3 - ? -
23 PsiBlast_CBE 62.1143% -31 - C2 -1UE1 - SSB_MYCTU -
25 PsiBlast_CBE 61.8937% -56 - C2 -2VW9 - SSB_HELPY -
10 PsiBlast_PDB 61.4137% -48 - C2 -2VW9 - SSB_HELPY -
43 HHSearch 61.2336% -46 - C2 -2VW9 - SSB_HELPY -
57 HHSearch 61.1932% -64 - C2 -1SE8 - SSB_DEIRA -
5 PsiBlast_PDB 60.6745% -24 - C2 -3A5U - SSB_MYCS2 -
22 PsiBlast_CBE 60.6643% -60 - C2 -1UE5 - SSB_MYCTU -
6 PsiBlast_PDB 60.5543% -41 - C2 -1UE1 - SSB_MYCTU -
7 PsiBlast_PDB 60.1643% -41 - C2 -1UE5 - SSB_MYCTU -
4 PsiBlast_PDB 60.0545% -26 - C2 -1X3G - SSB_MYCS2 -
16 PsiBlast_PDB 59.9338% -1 - C2 -1EYG - SSB_ECOLI -
51 HHSearch 59.8825% -46 - C2 -3ULP - ? -