@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu36520: (2016-07-31 )
MSGQMFKVEIVTRPANFEKLKQELGKIGVTSLTFSNVHGCGLQKAHTELYRGVKIESNVYERLKIEIVVSKVPVDQVTETAKRVLKTGSPGDGKIFVYEISNTINIRTGEEGPEAL

Atome Classification :

(49 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_C_8(1UL3)
GLNB_SYNY3
[Raw transfer]




ATP_C_14(2RD5)
GLNB_ARATH
[Raw transfer]




ATP_A_5(4USI)
?
[Raw transfer]




ATP_A_7(2XUL)
GLNB_SYNE7
[Raw transfer]




ADP_A_3(4CO2)
?
[Raw transfer]




ATP_A_2(4AFF)
GLNB_SYNE7
[Raw transfer]




ATP_A_4(2J9E)
Y059_METJA
[Raw transfer]




ATP_A_2(4AFF)
GLNB_SYNE7
[Raw transfer]




ATP_C_16(2XZW)
GLNB_SYNE7
[Raw transfer]




ADP_A_3(4CO1)
?
[Raw transfer]




ATP_A_4(3NCQ)
?
[Raw transfer]




ATP_G_24(2XZW)
GLNB_SYNE7
[Raw transfer]




ADP_F_11(4C3K)
GLNB_SYNE7
[Raw transfer]




ADP_B_5(4CO2)
?
[Raw transfer]




ATP_H_25(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_C_16(2J9C)
Y059_METJA
[Raw transfer]




ATP_F_21(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_B_10(2XUL)
GLNB_SYNE7
[Raw transfer]




ATP_D_16(2XUL)
GLNB_SYNE7
[Raw transfer]




ATP_B_11(2J9C)
Y059_METJA
[Raw transfer]




ATP_E_19(2XUL)
GLNB_SYNE7
[Raw transfer]




ATP_B_6(4RX6)
NRGB_BACSU
[Raw transfer]




ATP_B_13(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_A_4(2J9C)
Y059_METJA
[Raw transfer]




ADP_B_11(2NS1)
GLNK_ECOLI
[Raw transfer]




ATP_C_10(2J9E)
Y059_METJA
[Raw transfer]




ADP_B_11(2NS1)
GLNK_ECOLI
[Raw transfer]




ATP_A_4(2J9C)
Y059_METJA
[Raw transfer]




ADP_D_9(4C3K)
GLNB_SYNE7
[Raw transfer]




ATP_E_20(2XZW)
GLNB_SYNE7
[Raw transfer]




ADP_C_8(4C3K)
GLNB_SYNE7
[Raw transfer]




ADP_B_4(4CO1)
?
[Raw transfer]




ATP_D_19(2XZW)
GLNB_SYNE7
[Raw transfer]




ATP_B_8(2J9E)
Y059_METJA
[Raw transfer]




ADP_A_3(3N5B)
?
[Raw transfer]




ATP_B_5(4RX6)
NRGB_BACSU
[Raw transfer]




GOL_A_7(1UL3)
GLNB_SYNY3
[Raw transfer]




ADP_E_10(4C3K)
GLNB_SYNE7
[Raw transfer]




AKG_F_22(2XZW)
GLNB_SYNE7
[Raw transfer]




AKG_E_20(2XUL)
GLNB_SYNE7
[Raw transfer]




FLC_D_4(2O66)
GLNB_ARATH
[Raw transfer]




113 HHSearch 91.6398%-138 - C4 -4R25 - NRGB_BACSU -
2 PsiBlast_PDB 91.5399%-139 - C4 -4R25 - NRGB_BACSU -
22 PsiBlast_CBE 91.20100%-126 - C4 -4RX6 4.8 NRGB_BACSU
21 PsiBlast_CBE 90.49100%-141 - C4 -4RX6 3.7 NRGB_BACSU
1 PsiBlast_PDB 89.35100%-135 - C4 -4RX6 - NRGB_BACSU -
81 PsiBlast_CBE 71.7935%-157 - C4 -3LF0 - GLNB_MYCTU -
52 PsiBlast_CBE 70.2441%-101 - C4 -2V5H - GLNB_SYNE7 -
38 PsiBlast_CBE 69.7541%-142 - C4 -4C3K - GLNB_SYNE7 -
80 PsiBlast_CBE 69.5535%-126 - C4 -3LF0 - GLNB_MYCTU -
49 PsiBlast_CBE 69.4141%-113 - C4 -2XUL 6.6 GLNB_SYNE7
32 PsiBlast_CBE 69.3341% -93 - C4 -1QY7 - GLNB_SYNE7 -
17 PsiBlast_PDB 69.1041%-115 - C4 -2XUL 6.5 GLNB_SYNE7
3 PsiBlast_PDB 68.9141%-118 - C4 -1PIL - GLNB_ECOLI -
4 PsiBlast_PDB 68.9041%-111 - C4 -2PII - GLNB_ECOLI -
118 HHSearch 68.7338%-124 - C4 -2NS1 4.7 GLNK_ECOLI
8 PsiBlast_PDB 68.7338%-124 - C4 -2NS1 4.7 GLNK_ECOLI
42 PsiBlast_CBE 68.7241%-107 - C4 -2XZW 6.8 GLNB_SYNE7
54 PsiBlast_CBE 68.5041% -85 - C4 -2V5H - GLNB_SYNE7 -
119 HHSearch 68.3641%-118 - C4 -4AFF 6.5 GLNB_SYNE7
14 PsiBlast_PDB 68.3641%-118 - C4 -4AFF 6.5 GLNB_SYNE7
44 PsiBlast_CBE 68.1241%-126 - C4 -2XZW 6.1 GLNB_SYNE7
45 PsiBlast_CBE 67.6941%-101 - C4 -2XZW 7.0 GLNB_SYNE7
41 PsiBlast_CBE 67.5641%-106 - C4 -2XZW 5.0 GLNB_SYNE7
99 PsiBlast_CBE 67.0941%-103 - C4 -3N5B 4.9 ?
37 PsiBlast_CBE 66.6341%-127 - C4 -4C3K 5.0 GLNB_SYNE7
84 PsiBlast_CBE 66.3841% -95 - C4 -2J9E 5.3 Y059_METJA
35 PsiBlast_CBE 66.2441%-125 - C4 -4C3K 3.3 GLNB_SYNE7
34 PsiBlast_CBE 66.1941%-121 - C4 -4C3K 4.7 GLNB_SYNE7
47 PsiBlast_CBE 66.0441%-108 - C4 -2XUL 6.7 GLNB_SYNE7
40 PsiBlast_CBE 65.9441% -97 - C4 -2XZW 6.3 GLNB_SYNE7
48 PsiBlast_CBE 65.7041%-108 - C4 -2XUL 6.5 GLNB_SYNE7
46 PsiBlast_CBE 65.6741%-102 - C4 -2XZW 6.9 GLNB_SYNE7
78 PsiBlast_CBE 65.5641%-127 - C4 -1UL3 3.2 GLNB_SYNY3
83 PsiBlast_CBE 65.4441% -87 - C4 -2J9E 6.5 Y059_METJA
85 PsiBlast_CBE 65.3141% -99 - C4 -2J9E 6.6 Y059_METJA
36 PsiBlast_CBE 64.9841%-130 - C4 -4C3K 4.5 GLNB_SYNE7
95 PsiBlast_CBE 64.4541% -94 - C4 -2J9C 5.4 Y059_METJA
127 HHSearch 63.5935%-103 - C4 -3NCQ 5.6 ?
97 PsiBlast_CBE 63.2241% -90 - C4 -2J9C 6.4 Y059_METJA
128 HHSearch 62.7041% -92 - C4 -2J9C 6.4 Y059_METJA
96 PsiBlast_CBE 62.5941% -91 - C4 -2J9C 6.7 Y059_METJA
63 PsiBlast_CBE 61.7038% -85 - C4 -4CO1 5.9 ?
61 PsiBlast_CBE 61.6138% -88 - C4 -4CO2 5.8 ?
60 PsiBlast_CBE 61.5338% -88 - C4 -4CO2 5.2 ?
43 PsiBlast_CBE 61.4241%-122 - C4 -2XZW 5.0 GLNB_SYNE7
122 HHSearch 61.0139% -59 - C4 -2O66 2.2 GLNB_ARATH
62 PsiBlast_CBE 60.7638% -90 - C4 -4CO1 5.2 ?
114 HHSearch 60.1436% -55 - C4 -4USI 2.4 ?
101 PsiBlast_CBE 57.5239% -32 - C4 -2RD5 2.2 GLNB_ARATH