@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu36600: (2016-07-31 )
MRGGNRLGAGRKVIPESEKKKRKSVYITDKLYTRIMDTDIENCNNFSQKCMALIELAMENLNKNNQEHSVKRNNILMVRDTKSTYNKTNNNFEKQNRGIKLTFIDLFAGIGGIRLGFEDKYTKCVFSSEWDKYAAQTYEANYGEKPHGDITKINENDIPDQDVLLAGFPCQPFSNIGKREGFAHERRNIIFDVLRILKKKQPKMFLLENVKGLLTNDNGNTFRVILDNLKSLGYSVFYEVMDAQNFGLPQRRERIVIVGFHPDLGINDFSFPKGNPDNKVPINAILEHNPTGYSISKRLQESYLFKKDDGKPQIVDFRCTYQVNTLVASYHKIQRLTGTFVKDGETGLRLFSELELKRLMGFPVDFKVPVSRTQMYRQFGNSVAVPMIKAVAGAMKERLLLAEMQVLKK

Atome Classification :

(32 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAH_B_6(1SVU)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(1SKM)
MTH1_HAEPH
[Raw transfer]




SAH_A_4(5CIY)
?
[Raw transfer]




SAH_D_4(4MHT)
MTH1_HAEPH
[Raw transfer]




SAH_A_4(2C7P)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(9MHT)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(2HR1)
MTH1_HAEPH
[Raw transfer]




SAH_A_4(5CIY)
?
[Raw transfer]




SAH_A_4(2C7Q)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(8MHT)
MTH1_HAEPH
[Raw transfer]




SAH_A_5(1SVU)
MTH1_HAEPH
[Raw transfer]




SAH_A_4(2C7O)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(2I9K)
MTH1_HAEPH
[Raw transfer]




SAH_A_6(2Z6Q)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(3MHT)
MTH1_HAEPH
[Raw transfer]




SAH_A_10(2UYC)
MTH1_HAEPH
[Raw transfer]




SAH_A_8(2UYH)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(1M0E)
MTH1_HAEPH
[Raw transfer]




SAH_A_4(2C7R)
MTH1_HAEPH
[Raw transfer]




SAH_A_8(2UZ4)
MTH1_HAEPH
[Raw transfer]




SAH_A_4(2ZCJ)
MTH1_HAEPH
[Raw transfer]




SAH_A_4(2Z6U)
MTH1_HAEPH
[Raw transfer]




SAH_A_4(2Z6A)
MTH1_HAEPH
[Raw transfer]




SAM_D_4(6MHT)
MTH1_HAEPH
[Raw transfer]




SAM_B_2(2HMY)
MTH1_HAEPH
[Raw transfer]




SAM_A_4(3EEO)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(7MHT)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(10MH)
MTH1_HAEPH
[Raw transfer]




SAH_D_4(1MHT)
MTH1_HAEPH
[Raw transfer]




DCZ_A_5(2Z6Q)
MTH1_HAEPH
[Raw transfer]




EDO_A_24(3SWR)
DNMT1_HUMAN
[Raw transfer]




SAM_B_2(1HMY)
MTH1_HAEPH
[Raw transfer]




ATP_Y_11(3UBT)
MTH3_HAEAE
[Raw transfer]




NACID_D_2(6MHT)
MTH1_HAEPH
[Raw transfer]

-

NACID_D_2(5MHT)
MTH1_HAEPH
[Raw transfer]

-

7 PsiBlast_PDB 88.2939% -69 - C4 -8MHT 7.4 MTH1_HAEPH
19 PsiBlast_PDB 87.8139% -60 - C4 -5CIY 8.3 ?
31 PsiBlast_CBE 87.7139% -61 - C4 -2Z6A 7.5 MTH1_HAEPH
6 PsiBlast_PDB 87.0639% -63 - C4 -7MHT 7.6 MTH1_HAEPH
1 PsiBlast_PDB 87.0539% -64 - C4 -1MHT 7.8 MTH1_HAEPH
8 PsiBlast_PDB 87.0439% -65 - C4 -9MHT 7.7 MTH1_HAEPH
5 PsiBlast_PDB 86.7039% -62 - C4 -6MHT 10.0 MTH1_HAEPH
21 PsiBlast_CBE 86.6539% -59 - C4 -2UYH 8.3 MTH1_HAEPH
42 HHSearch 86.5240% -64 * C4 *5CIY 8.3 ?
25 PsiBlast_CBE 86.4339% -62 - C4 -2Z6U 7.8 MTH1_HAEPH
12 PsiBlast_PDB 86.2039% -62 - C4 -1SKM 8.4 MTH1_HAEPH
2 PsiBlast_PDB 86.0739% -65 - C4 -3MHT 7.4 MTH1_HAEPH
24 PsiBlast_CBE 86.0339% -61 - C4 -2ZCJ 7.9 MTH1_HAEPH
34 Fugue 85.9838% -73 - C4 -6MHT 8.5 MTH1_HAEPH
26 PsiBlast_CBE 85.9839% -59 - C4 -2Z6Q 7.8 MTH1_HAEPH
3 PsiBlast_PDB 85.9639% -59 - C4 -4MHT 7.5 MTH1_HAEPH
27 PsiBlast_CBE 85.8139% -60 - C4 -2UZ4 8.4 MTH1_HAEPH
14 PsiBlast_PDB 85.7639% -57 - C4 -2C7P 8.3 MTH1_HAEPH
13 PsiBlast_PDB 85.7139% -59 - C4 -2C7O 8.4 MTH1_HAEPH
9 PsiBlast_PDB 85.5039% -61 - C4 -10MH 8.1 MTH1_HAEPH
20 PsiBlast_PDB 85.0840% -64 - C4 -2I9K 7.7 MTH1_HAEPH
11 PsiBlast_PDB 85.0339% -63 - C4 -1M0E 8.2 MTH1_HAEPH
18 PsiBlast_PDB 84.9939% -58 - C4 -3EEO 8.3 MTH1_HAEPH
16 PsiBlast_PDB 84.9239% -59 - C4 -2HR1 7.8 MTH1_HAEPH
4 PsiBlast_PDB 84.9039% -61 - C4 -5MHT 7.5 MTH1_HAEPH
15 PsiBlast_PDB 84.8939% -56 - C4 -2C7Q 8.2 MTH1_HAEPH
28 PsiBlast_CBE 84.8839% -57 - C4 -2UYC 8.5 MTH1_HAEPH
29 PsiBlast_CBE 82.9439% -65 - C4 -2C7R 8.5 MTH1_HAEPH
17 PsiBlast_PDB 82.2939% -59 - C4 -1HMY 3.7 MTH1_HAEPH
10 PsiBlast_PDB 81.0639% -57 - C4 -2HMY 8.4 MTH1_HAEPH
23 PsiBlast_CBE 81.0539% -67 - C4 -1SVU 7.0 MTH1_HAEPH
22 PsiBlast_CBE 80.8339% -60 - C4 -1SVU 7.9 MTH1_HAEPH