@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu36700: (2016-08-01 )
MITESRQMLDKRNRPLRDLRISVTDRCNFRCTYCMPAELFGPDYPFLKKEELLSFEELERLATLFVTRFGVEKIRLTGGEPLMRKDMPELIKKLARIPGIRDIAMTTNGSLLPVYAKRLKEAGLKRVTISLDSLEDERFKKINGRGVSVSKVLEGIEAAKQAGLGVKINMVVQKGVNEKDILPMARYFKEKGHILRFIEFMDVGNTNQWEKKDVMTKAEIIDLINKHMPVEPIAPNYIGEVASRFRYLDGSGEIGVISSVSDAFCGSCNRARLSARGELFTCLFASSGFDLRAPVRQELSDDELSEMIGTVWKNRIDQYSVDRTLSKASGKKKVEMSYIGG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GTP_A_9(2FB3)
MOAA_STAA8
[Raw transfer]




SAM_B_6(2FB2)
MOAA_STAA8
[Raw transfer]




SAM_A_5(2FB2)
MOAA_STAA8
[Raw transfer]




SAM_A_5(1TV8)
MOAA_STAA8
[Raw transfer]




SAM_A_5(1TV8)
MOAA_STAA8
[Raw transfer]




SAM_A_5(1TV8)
MOAA_STAA8
[Raw transfer]




SAM_B_6(1TV8)
MOAA_STAA8
[Raw transfer]




POP_B_13(2FB3)
MOAA_STAA8
[Raw transfer]




DTU_A_11(1TV8)
MOAA_STAA8
[Raw transfer]




SF4_A_7(1TV8)
MOAA_STAA8
[Raw transfer]




SF4_B_8(1TV7)
MOAA_STAA8
[Raw transfer]




SF4_B_9(1TV8)
MOAA_STAA8
[Raw transfer]




SF4_A_6(1TV7)
MOAA_STAA8
[Raw transfer]




SF4_B_12(2FB3)
MOAA_STAA8
[Raw transfer]




5AD_A_10(2FB3)
MOAA_STAA8
[Raw transfer]




35 HHSearch 93.9150% -95 - C2 -1TV8 5.8 MOAA_STAA8
22 PsiBlast_CBE 93.7649% -98 - C2 -1TV8 5.5 MOAA_STAA8
2 PsiBlast_PDB 93.4849% -95 - C2 -1TV8 5.8 MOAA_STAA8
24 PsiBlast_CBE 93.4448%-101 - C2 -2FB2 5.9 MOAA_STAA8
4 PsiBlast_PDB 93.4448% -95 - C2 -2FB2 6.1 MOAA_STAA8
25 Fugue 93.1149% -93 - C2 -1TV8 5.8 MOAA_STAA8
3 PsiBlast_PDB 92.8049% -92 - C2 -2FB3 6.1 MOAA_STAA8
1 PsiBlast_PDB 92.3349% -93 - C2 -1TV7 2.8 MOAA_STAA8
21 PsiBlast_CBE 91.5949% -93 - C2 -2FB3 3.7 MOAA_STAA8
23 PsiBlast_CBE 91.5149% -92 - C2 -1TV7 3.9 MOAA_STAA8
32 Fugue 43.3415% 15 - C2 -2YX0 - TYW1_PYRHO -
51 HHSearch 42.1720% -26 - C2 -4RTB - ? -
46 HHSearch 41.7818% -20 - C2 -3T7V - PYLB_METBF -
33 Fugue 41.7617% 38 - C2 -1R30 - BIOB_ECOLI -
41 HHSearch 41.0517% -42 - C2 -2A5H - KAMA_CLOSU -
5 PsiBlast_PDB 40.5327% 10 - C2 -4K36 - ANSME_CLOP1 -
31 Fugue 40.2622% 29 - C2 -4K36 - ANSME_CLOP1 -
7 PsiBlast_PDB 39.5226% 6 - C2 -4K38 - ANSME_CLOP1 -
8 PsiBlast_PDB 39.1626% 10 - C2 -4K39 - ANSME_CLOP1 -
42 HHSearch 38.7716% -14 - C2 -2YX0 - TYW1_PYRHO -