@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu36800: (2016-08-01 )
MKTVKVNIVTPDGPVYDADIEMVSVRAESGDLGILPGHIPTVAPLKIGAVRLKKDGQTEMVAVSGGFVEVRPDHVTILAQAAETAEGIDKERAEAARQRAQERLNSQSDDTDIRRAELALQRALNRLDVAGK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_D_4(2E5Y)
ATPE_BACP3
[Raw transfer]




ATP_D_4(2E5Y)
ATPE_BACP3
[Raw transfer]




21 PsiBlast_CBE 88.5870%-114 - C1 -2E5Y 6.4 ATPE_BACP3
36 HHSearch 87.4170%-116 - C1 -2E5Y Error ATPE_BACP3
1 PsiBlast_PDB 86.9470%-118 - C1 -2E5Y - ATPE_BACP3 -
39 HHSearch 68.4036% -99 - C1 -2RQ6 - ATPE_THEEB -
38 HHSearch 65.3833% -63 * C1 *1AQT - ATPE_ECOLI -
5 PsiBlast_PDB 64.2133% -67 - C1 -1AQT - ATPE_ECOLI -
40 HHSearch 62.4526%-101 - C1 -3ZIA - ATPD_YEAST -
10 PsiBlast_PDB 61.9933% -93 - C1 -2RQ7 - ATPE_SPIOL (first) -
11 PsiBlast_PDB 60.5538%-168 - C1 -2RQ6 - ATPE_THEEB -
8 PsiBlast_PDB 60.4633%-111 - C1 -1FS0 - ATPE_ECOLI -
7 PsiBlast_PDB 60.0833% -72 - C1 -1BSN - ATPE_ECOLI -
35 HHSearch 58.8147%-118 - C- -2QE7 - ? -
3 PsiBlast_PDB 58.7646%-118 - C- -2QE7 - ? -
4 PsiBlast_PDB 58.4833% - - C1 -1QO1 - ATPE_ECOLI -
2 PsiBlast_PDB 57.7569% 28 - C1 -4XD7 - ATPE_GEOKA -
26 Fugue 57.5527% -20 - C1 -1E79 - ATPD_BOVIN -
6 PsiBlast_PDB 57.1933% -70 - C1 -1BSH - ATPE_ECOLI -
27 Fugue 56.8734%-113 - C1 -1AQT - ? -
9 PsiBlast_PDB 55.8833% 0 - C- -3OAA - ATPE_ECOLI -
16 PsiBlast_PDB 50.5428%-114 - C1 -2XOK - ATPD_YEAST -