@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu37730: (2016-08-02 )
MNLTDKTVLITGGASGIGYAAVQAFLNQQANVVVADIDEAQGEAMIRKENNDRLHFVHTDITDEPACQNAIRSAVDKFGGLDVLINNAGIEIVAPIHEMELSNWNKVLNVNLTGMFLMSKHALKYMLKSGKGNIINTCSVGGVVAWPDIPAYNASKGGVLQLTRSMAVDYAKHNIRVNCVCPGIIDTPLNEKSFLENNEGTLEEIKKEKAKVNPLLRLGKPEEIANVMLFLASDLSSYMTGSAITADGGYTAQ

Atome Classification :

(47 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_B_6(4NBU)
?
[Raw transfer]




NAI_E_5(2DTE)
?
[Raw transfer]




NAI_D_9(4NBU)
?
[Raw transfer]




NAI_G_7(2DTE)
?
[Raw transfer]




NAI_A_5(4NBU)
?
[Raw transfer]




NAI_C_8(4NBU)
?
[Raw transfer]




NAP_A_3(4RF2)
?
[Raw transfer]




NAD_L_12(1GEE)
DHG_BACME
[Raw transfer]




NAP_B_6(4RF2)
?
[Raw transfer]




NAD_O_15(1GCO)
DHG_BACME
[Raw transfer]




NAD_A_5(2HSD)
HSD_STREX
[Raw transfer]




NAD_M_13(1GCO)
DHG_BACME
[Raw transfer]




NAD_B_6(2HSD)
HSD_STREX
[Raw transfer]




NAD_O_15(1RWB)
DHG_BACME
[Raw transfer]




NAD_J_10(1GEE)
DHG_BACME
[Raw transfer]




NAD_K_11(1GCO)
DHG_BACME
[Raw transfer]




NAD_I_9(1RWB)
DHG_BACME
[Raw transfer]




NAD_I_9(1GCO)
DHG_BACME
[Raw transfer]




NAD_K_11(1GEE)
DHG_BACME
[Raw transfer]




NAD_I_9(1GEE)
DHG_BACME
[Raw transfer]




NAD_D_8(2HSD)
HSD_STREX
[Raw transfer]




NAD_K_11(1RWB)
DHG_BACME
[Raw transfer]




NAD_J_10(1G6K)
DHG_BACME
[Raw transfer]




NAD_C_7(2HSD)
HSD_STREX
[Raw transfer]




NAD_D_18(4WEC)
?
[Raw transfer]




NAD_M_13(1RWB)
DHG_BACME
[Raw transfer]




NAD_C_15(4WEC)
?
[Raw transfer]




NAD_I_9(1G6K)
DHG_BACME
[Raw transfer]




NAD_B_10(4WEC)
?
[Raw transfer]




NAD_A_5(4WEC)
?
[Raw transfer]




THJ_A_4(3GED)
?
[Raw transfer]




37 PsiBlast_CBE 85.4940%-109 - C1 -4NBU 8.5 ?
70 PsiBlast_CBE 84.6037%-107 - C1 -1NFQ - HSD_MYCTU -
69 PsiBlast_CBE 84.0537%-107 - C1 -1NFQ - HSD_MYCTU -
122 HHSearch 84.0243%-124 * C1 *4NI5 - ? -
67 PsiBlast_CBE 83.9437%-107 - C1 -1NFQ - HSD_MYCTU -
38 PsiBlast_CBE 83.7840%-108 - C1 -4NBU 10.3 ?
77 PsiBlast_CBE 83.3534% -98 - C1 -2DTD - ? -
71 PsiBlast_CBE 83.3237%-105 - C1 -1NFF - HSD_MYCTU -
73 PsiBlast_CBE 82.6134% -95 - C1 -2DTX - ? -
68 PsiBlast_CBE 82.6137%-106 - C1 -1NFQ - HSD_MYCTU -
113 HHSearch 82.5435% -73 - C1 -3WDS - ? -
72 PsiBlast_CBE 82.4937%-107 - C1 -1NFF - HSD_MYCTU -
48 PsiBlast_CBE 82.1935% -69 - C1 -3AK4 - ? -
36 PsiBlast_CBE 82.1240%-109 - C1 -4NBU 8.7 ?
45 PsiBlast_CBE 82.1135% -72 - C1 -3WDS - ? -
15 PsiBlast_PDB 81.8735% -66 - C1 -3WDS - ? -
7 PsiBlast_PDB 81.7740% -87 - C1 -3VTZ - ? -
47 PsiBlast_CBE 81.4235% -68 - C1 -3WDS - ? -
74 PsiBlast_CBE 81.4034% -96 - C1 -2DTX - ? -
11 PsiBlast_PDB 81.4040%-109 - C1 -4NBU 8.5 ?
75 PsiBlast_CBE 80.3734% -96 - C1 -2DTE 9.4 ?
95 PsiBlast_CBE 80.0336% -88 - C1 -2HSD 8.8 HSD_STREX
76 PsiBlast_CBE 79.9234% -96 - C1 -2DTE 11.8 ?
30 PsiBlast_CBE 78.7340% -22 - C1 -1GEE 7.4 DHG_BACME
32 PsiBlast_CBE 78.3540% -21 - C1 -1GEE 7.9 DHG_BACME
93 PsiBlast_CBE 78.2436% -86 - C1 -2HSD 7.6 HSD_STREX
94 PsiBlast_CBE 78.0736% -89 - C1 -2HSD 7.7 HSD_STREX
31 PsiBlast_CBE 77.8440% -21 - C1 -1GEE 7.9 DHG_BACME
33 PsiBlast_CBE 77.8240% -20 - C1 -1GCO 7.1 DHG_BACME
35 PsiBlast_CBE 77.7540% -20 - C1 -1GCO 7.5 DHG_BACME
41 PsiBlast_CBE 77.6740% -22 - C1 -1G6K 6.8 DHG_BACME
9 PsiBlast_PDB 77.5440% -21 - C1 -1GEE 7.6 DHG_BACME
10 PsiBlast_PDB 77.4240% -20 - C1 -1GCO 6.5 DHG_BACME
34 PsiBlast_CBE 77.1040% -20 - C1 -1GCO 7.3 DHG_BACME
27 PsiBlast_CBE 76.1740% -23 - C1 -1RWB 7.4 DHG_BACME
12 PsiBlast_PDB 76.0140% -21 - C1 -1G6K 6.2 DHG_BACME
8 PsiBlast_PDB 75.8340% -21 - C1 -1RWB 8.6 DHG_BACME
28 PsiBlast_CBE 75.0440% -24 - C1 -1RWB 8.5 DHG_BACME
29 PsiBlast_CBE 74.5640% -21 - C1 -1RWB 8.0 DHG_BACME
92 PsiBlast_CBE 74.1836% -87 - C1 -2HSD 8.0 HSD_STREX
43 PsiBlast_CBE 73.2239% -29 - C1 -4WEC 9.6 ?
44 PsiBlast_CBE 72.5239% -28 - C1 -4WEC 7.3 ?
13 PsiBlast_PDB 72.1639% -25 - C1 -4WEC 7.1 ?
42 PsiBlast_CBE 70.7439% -29 - C1 -4WEC 9.8 ?
91 PsiBlast_CBE 69.7235% -18 - C1 -4RF2 10.6 ?
90 PsiBlast_CBE 68.9435% -19 - C1 -4RF2 10.5 ?
108 HHSearch 66.3230%-126 - C1 -3GED 3.2 ?