@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu37910: (2016-08-03 )
MPKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYAALINQAIEMAEGEYITYATDDNIYMPDRLLKMVRELDTHPEKAVIYSASKTYHLNENRDIVKETVRPAAQVTWNAPCAIDHCSVMHRYSVLEKVKEKFGSYWDESPAFYRIGDARFFWRVNHFYPFYPLDEELDLNYITDQSIHFQLFELEKNEFVRNLPPQRNCRELRESLKKLGMG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UDP_A_4(1QGQ)
SPSA_BACSU
[Raw transfer]




TYD_A_3(1H7Q)
SPSA_BACSU
[Raw transfer]




UDP_A_4(1QGS)
SPSA_BACSU
[Raw transfer]




TYD_A_3(1H7L)
SPSA_BACSU
[Raw transfer]




GOL_A_4(1QG8)
SPSA_BACSU
[Raw transfer]




GOL_A_4(1QG8)
SPSA_BACSU
[Raw transfer]




3 PsiBlast_PDB 88.68100%-106 - C4 -1QGS 4.0 SPSA_BACSU
1 PsiBlast_PDB 88.36100%-100 - C4 -1QG8 - SPSA_BACSU -
2 PsiBlast_PDB 88.13100%-100 - C4 -1QGQ 4.4 SPSA_BACSU
5 PsiBlast_PDB 88.04100% -97 - C4 -1H7Q 4.4 SPSA_BACSU
4 PsiBlast_PDB 87.84100% -99 - C4 -1H7L 4.6 SPSA_BACSU
41 Fugue 87.5999% -99 - C4 -1QG8 4.1 SPSA_BACSU
15 HHSearch 81.5194% -9 - C4 -1QG8 4.1 SPSA_BACSU
6 PsiBlast_PDB 45.7927% -91 - C4 -2Z87 - CHS_ECOLX -
16 HHSearch 44.8619% -78 - C4 -3BCV - ? -
7 PsiBlast_PDB 43.5327% -91 - C4 -2Z86 - CHS_ECOLX -
42 Fugue 42.1618% 10 - C4 -2Z86 - CHS_ECOLX -
32 HHSearch 39.3914% -31 - C4 -2ZU9 - MPGS_PYRHO -
11 PsiBlast_PDB 38.5541%-235 - C3 -3HS3 - ? -
26 HHSearch 38.4314% -7 - C4 -4FIX - GLFT2_MYCTU -
22 HHSearch 37.1712% -8 - C4 -3F1Y - ? -
8 PsiBlast_PDB 36.5829%-122 - C4 -3BCV - ? -
38 HHSearch 36.4516% -4 - C4 -1V84 - B3GA1_HUMAN -
43 Fugue 36.1920% -3 - C4 -3BCV - ? -
21 HHSearch 35.4914% -10 - C4 -5AJO - GALT2_HUMAN -
24 HHSearch 35.1814% -34 - C4 -3CKJ - GPGS_MYCPA -