@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu38020: (2016-08-03 )
MSMHKALTIAGSDSSGGAGIQADLKTFQEKNVYGMTALTVIVAMDPNNSWNHQVFPIDTDTIRAQLATITDGIGVDAMKTGMLPTVDIIELAAKTIKEKQLKNVVIDPVMVCKGANEVLYPEHAQALREQLAPLATVITPNLFEASQLSGMDELKTVDDMIEAAKKIHALGAQYVVITGGGKLKHEKAVDVLYDGETAEVLESEMIDTPYTHGAGCTFSAAVTAELAKGAEVKEAIYAAKEFITAAIKESFPLNQYVGPTKHSALRLNQQS

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_H_8(2I5B)
PDXK_BACSU
[Raw transfer]




ADP_G_7(2I5B)
PDXK_BACSU
[Raw transfer]




ADP_I_9(2I5B)
PDXK_BACSU
[Raw transfer]




ACP_B_8(4C5N)
?
[Raw transfer]




ACP_D_16(4C5N)
?
[Raw transfer]




ACP_C_12(4C5N)
?
[Raw transfer]




PLP_A_2(4YWR)
?
[Raw transfer]




ADP_C_13(4C5K)
?
[Raw transfer]




ACP_D_20(4C5M)
?
[Raw transfer]




UEG_D_11(4C5L)
?
[Raw transfer]




ADP_B_9(4C5K)
?
[Raw transfer]




ACP_B_10(4C5M)
?
[Raw transfer]




UEG_C_10(4C5L)
?
[Raw transfer]




ACP_C_15(4C5M)
?
[Raw transfer]




ADP_A_5(4C5K)
?
[Raw transfer]




HMH_H_8(1JXI)
THID_SALTY
[Raw transfer]




ADP_D_17(4C5K)
?
[Raw transfer]




EDO_A_3(4YL5)
?
[Raw transfer]




78 HHSearch 96.02100% -89 - C2 -2I5B 7.4 PDXK_BACSU
1 PsiBlast_PDB 96.02100% -89 - C2 -2I5B - PDXK_BACSU -
23 PsiBlast_CBE 95.99100% -91 - C2 -2I5B 7.4 PDXK_BACSU
21 PsiBlast_CBE 95.58100% -94 - C2 -2I5B - PDXK_BACSU -
22 PsiBlast_CBE 94.41100% -90 - C2 -2I5B 7.1 PDXK_BACSU
24 PsiBlast_CBE 92.00100% -90 - C2 -2I5B - PDXK_BACSU -
3 PsiBlast_PDB 81.4450% -90 - C2 -4C5K - ? -
33 PsiBlast_CBE 81.1050% -88 - C2 -4C5K 4.5 ?
38 PsiBlast_CBE 80.9950% -87 - C2 -4C5J - ? -
6 PsiBlast_PDB 80.9850% -89 - C2 -4C5N - ? -
35 PsiBlast_CBE 80.9550% -87 - C2 -4C5K 4.4 ?
5 PsiBlast_PDB 80.8750% -89 - C2 -4C5M - ? -
30 PsiBlast_CBE 80.5850% -87 - C2 -4C5M 5.3 ?
25 PsiBlast_CBE 80.4750% -93 - C2 -4C5N 4.4 ?
26 PsiBlast_CBE 80.3650% -90 - C2 -4C5N 5.2 ?
34 PsiBlast_CBE 80.2850% -87 - C2 -4C5K 4.4 ?
2 PsiBlast_PDB 80.1750% -86 - C2 -4C5J - ? -
37 PsiBlast_CBE 80.0050% -86 - C2 -4C5J - ? -
28 PsiBlast_CBE 79.9250% -88 - C2 -4C5M 5.3 ?
31 PsiBlast_CBE 79.7050% -85 - C2 -4C5L 3.4 ?
29 PsiBlast_CBE 79.1950% -88 - C2 -4C5M 5.3 ?
27 PsiBlast_CBE 78.9650% -88 - C2 -4C5N 5.4 ?
32 PsiBlast_CBE 78.4650% -85 - C2 -4C5L 2.7 ?
40 PsiBlast_CBE 70.9135% -89 - C2 -1JXI 3.3 THID_SALTY
80 HHSearch 68.4650% 10 * C2 *4C5K 5.0 ?
11 PsiBlast_PDB 50.4830% -15 - C2 -4YL5 2.0 ?
12 PsiBlast_PDB 48.7130% -12 - C2 -4YWR 2.4 ?