@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu38110: (2016-08-03 )
MNNTIETILNHRSIRSFTDQLLTAEEIDTLVKSAQAASTSSYVQAYSIIGVSDPEKKRELSVLAGNQPYVEKNGHFFVFCADLYRHQQLAEEKGEHISELLENTEMFMVSLIDAALAAQNMSIAAESMGLGICYIGGIRNELDKVTEVLQTPDHVLPLFGLAVGHPANLSGKKPRLPKQAVYHENTYNVNTDDFRHTMNTYDKTISDYYRERTNGKREETWSDQILNFMKQKPRTYLNDYVKEKGFNKN

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_3(5HDJ)
?
[Raw transfer]




FMN_A_5(3N2S)
NFRA1_BACSU
[Raw transfer]




FMN_A_5(3N2S)
NFRA1_BACSU
[Raw transfer]




FMN_D_4(1F5V)
NFSA_ECOLI
[Raw transfer]




FMN_C_3(1F5V)
NFSA_ECOLI
[Raw transfer]




FMN_C_3(1F5V)
NFSA_ECOLI
[Raw transfer]




FMN_A_4(1ZCH)
NFRA2_BACSU
[Raw transfer]




FMN_A_5(1BKJ)
FRP_VIBHA
[Raw transfer]




FMN_A_4(1ZCH)
NFRA2_BACSU
[Raw transfer]




43 HHSearch 87.77100%-105 - C3 -3N2S 8.4 NFRA1_BACSU
1 PsiBlast_PDB 87.1397%-105 - C3 -3N2S 8.4 NFRA1_BACSU
2 PsiBlast_PDB 77.0059%-101 - C3 -5HDJ 8.2 ?
44 HHSearch 70.7741%-115 - C3 -1F5V 8.1 NFSA_ECOLI
21 PsiBlast_CBE 68.3840%-119 - C3 -1F5V 7.6 NFSA_ECOLI
3 PsiBlast_PDB 68.1636%-111 - C3 -1ZCH 7.9 NFRA2_BACSU
4 PsiBlast_PDB 68.1040%-119 - C3 -1F5V 8.1 NFSA_ECOLI
5 PsiBlast_PDB 65.9639%-105 - C3 -5HEI - ? -
6 PsiBlast_PDB 62.4531%-146 - C3 -3EOF - ? -
45 HHSearch 61.0127%-105 - C3 -3EOF - ? -
64 Fugue 60.7744% -34 - C3 -1BKJ 8.5 FRP_VIBHA
42 HHSearch 60.5436% -29 * C3 *1ZCH 7.9 NFRA2_BACSU
54 HHSearch 53.6923% -54 - C3 -1NOX - NOX_THET8 -
12 PsiBlast_PDB 49.7520% -90 - C3 -3GE5 - ? -
62 HHSearch 49.3219% -17 - C3 -4QLX - ? -
58 HHSearch 48.8518% -7 - C3 -3BEM - MHQN_BACSU -
53 HHSearch 48.7716% -59 - C3 -3OF4 - ? -
59 HHSearch 48.4621% 2 - C3 -3GBH - ? -
61 HHSearch 47.9917% -49 - C3 -3GB5 - IYD1_MOUSE -
60 HHSearch 47.7624% -13 - C3 -3GE6 - ? -