@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu38290: (2016-08-03 )
MTRISREMMKELLSVYFIMGSNNTKADPVTVVQKALKGGATLYQFREKGGDALTGEARIKFAEKAQAACREAGVPFIVNDDVELALNLKADGIHIGQEDANAKEVRAAIGDMILGVSAHTMSEVKQAEEDGADYVGLGPIYPTETKKDTRAVQGVSLIEAVRRQGISIPIVGIGGITIDNAAPVIQAGADGVSMISAISQAEDPESAARKFREEIQTYKTGR

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

POP_B_9(1G67)
THIE_BACSU
[Raw transfer]




FQP_B_6(1G4P)
THIE_BACSU
[Raw transfer]




FTP_B_6(1G4T)
THIE_BACSU
[Raw transfer]




POP_B_9(1G69)
THIE_BACSU
[Raw transfer]




TPS_B_6(2TPS)
THIE_BACSU
[Raw transfer]




TPS_A_5(2TPS)
THIE_BACSU
[Raw transfer]




TPS_A_5(2TPS)
THIE_BACSU
[Raw transfer]




FQP_A_5(1G4P)
THIE_BACSU
[Raw transfer]




FTP_A_5(1G4T)
THIE_BACSU
[Raw transfer]




TPS_B_6(1G4S)
THIE_BACSU
[Raw transfer]




TPS_A_5(2TPS)
THIE_BACSU
[Raw transfer]




TPS_A_5(1G4S)
THIE_BACSU
[Raw transfer]




3NM_A_2(3O15)
THIE_BACSU
[Raw transfer]




IFP_A_5(1G6C)
THIE_BACSU
[Raw transfer]




IFP_B_8(1G6C)
THIE_BACSU
[Raw transfer]




TZP_B_10(1G69)
THIE_BACSU
[Raw transfer]




TZP_A_7(1G67)
THIE_BACSU
[Raw transfer]




TZP_A_7(1G67)
THIE_BACSU
[Raw transfer]




TZP_A_7(1G69)
THIE_BACSU
[Raw transfer]




TZP_A_7(1G6C)
THIE_BACSU
[Raw transfer]




TZP_B_10(1G67)
THIE_BACSU
[Raw transfer]




TZP_B_10(1G6C)
THIE_BACSU
[Raw transfer]




ICP_B_8(1G67)
THIE_BACSU
[Raw transfer]




ICP_B_8(1G69)
THIE_BACSU
[Raw transfer]




75 HHSearch 94.28100%-110 - C2 -2TPS 8.2 THIE_BACSU
2 PsiBlast_PDB 93.63100%-110 - C2 -2TPS 8.2 THIE_BACSU
22 PsiBlast_CBE 93.17100%-106 - C2 -1G4T 8.8 THIE_BACSU
3 PsiBlast_PDB 93.17100%-110 - C2 -1G4T 8.9 THIE_BACSU
26 PsiBlast_CBE 92.8499%-104 - C2 -1G69 5.4 THIE_BACSU
21 PsiBlast_CBE 92.70100%-114 - C2 -2TPS 8.7 THIE_BACSU
23 PsiBlast_CBE 92.6399%-107 - C2 -1G67 5.5 THIE_BACSU
7 PsiBlast_PDB 92.5899%-107 - C2 -1G69 5.2 THIE_BACSU
4 PsiBlast_PDB 92.5799%-108 - C2 -1G67 5.2 THIE_BACSU
24 PsiBlast_CBE 92.4599%-109 - C2 -1G4S 8.3 THIE_BACSU
10 PsiBlast_PDB 92.3599%-106 - C2 -1G6C 5.4 THIE_BACSU
27 PsiBlast_CBE 92.2199%-110 - C2 -1G6C 6.4 THIE_BACSU
6 PsiBlast_PDB 92.2199%-108 - C2 -1G4S 7.9 THIE_BACSU
1 PsiBlast_PDB 92.14100%-109 - C2 -3O15 4.8 THIE_BACSU
9 PsiBlast_PDB 88.2099%-117 - C2 -1G4E - THIE_BACSU -
25 PsiBlast_CBE 86.7699%-118 - C2 -1G4P 6.8 THIE_BACSU
8 PsiBlast_PDB 86.3199%-123 - C2 -3O16 - THIE_BACSU -
5 PsiBlast_PDB 86.1599%-112 - C2 -1G4P 6.0 THIE_BACSU
95 Fugue 81.9499% 21 - C2 -1G67 5.2 THIE_BACSU
94 Fugue 81.76100% 32 - C2 -2TPS 8.2 THIE_BACSU