@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu38540: (2016-08-04 )
MKMTNNTVLITGGSAGIGLELAKRLLELGNEVIICGRSEARLAEAKQQLPNIHTKQCDVADRSQREALYEWALKEYPNLNVLVNNAGIQKEIDFKKGTEELFVDGDEIELNFQAPVHLSALFTPHLMKQPEAAIVQVTSGLAFNPLAVYPVYCATKAALHSFSLTLRHQLRDTSVEVIEMAPPMVDTGLNQKSRDKQGLTYRGISSEEYVQYFLDGLKEGKQEITNERVEGLRDATRADYDRLFEQMNTQEN

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_E_5(1XKQ)
?
[Raw transfer]




NAP_A_5(3LF2)
?
[Raw transfer]




NAP_C_9(3LF2)
?
[Raw transfer]




GOL_B_8(3LF2)
?
[Raw transfer]




GOL_D_12(3LF2)
?
[Raw transfer]




1 PsiBlast_PDB 83.3433% 0 - C- -3ASU - ? -
31 HHSearch 82.0424%-101 - C1 -3GED - ? -
36 HHSearch 80.6123%-119 - C1 -1O5I - ? -
34 HHSearch 78.1422% -74 - C1 -2AG5 - BDH2_HUMAN -
15 PsiBlast_PDB 77.0726%-107 - C1 -4NBU - ? -
16 PsiBlast_PDB 76.6630% -27 - C- -4IUY - ? -
14 PsiBlast_PDB 75.5425% -56 - C1 -3O4R - DHRS4_HUMAN -
19 PsiBlast_PDB 75.3029% -50 - C1 -3AI1 - ? -
8 PsiBlast_PDB 75.2730% -51 - C1 -2AE2 - TRN2_DATST -
48 HHSearch 74.4024% -43 - C1 -1YB1 - DHB11_HUMAN -
37 HHSearch 73.8921% -35 - C1 -4G81 - ? -
7 PsiBlast_PDB 73.7230% -51 - C1 -1IPF - TRN2_DATST -
12 PsiBlast_PDB 73.0930% -10 - C1 -1XHL - ? -
56 Fugue 72.8524% 3 - C1 -1A4U - ADH_DROLE -
6 PsiBlast_PDB 72.6530% -48 - C1 -1IPE - TRN2_DATST -
20 PsiBlast_PDB 72.4929% -49 - C1 -3AI2 - ? -
50 HHSearch 72.0518% -46 - C1 -3WDS - ? -
11 PsiBlast_PDB 71.4330% -22 - C1 -1XKQ 10.2 ?
13 PsiBlast_PDB 71.3327% -58 - C1 -4NBV - ? -
43 HHSearch 71.0920% -35 - C1 -4FN4 - ? -
27 PsiBlast_CBE 60.6335% -41 - C1 -3LF2 6.5 ?
28 PsiBlast_CBE 60.3735% -39 - C1 -3LF2 2.7 ?
10 PsiBlast_PDB 59.7835% -34 - C1 -3LF2 6.7 ?
26 PsiBlast_CBE 58.6435% -38 - C1 -3LF2 2.7 ?