@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu38660: (2016-08-04 )
MLSIESLCKSYRHHEAVKNVSFHVNENECVALLGPNGAGKTTTLQMLAGLLSPTSGTIKLLGEKKLDRRLIGYLPQYPAFYSWMTANEFLTFAGRLSGLSKRKCQEKIGEMLEFVGLHEAAHKRIGGYSGGMKQRLGLAQALLHKPKFLILDEPVSALDPTGRFEVLDMMRELKKHMAVLFSTHVLHDAEQVCDQVVIMKNGEISWKGELQELKQQQQTNVFTLSVKEKLEGWLEEKPYVSAIVYKNPSQAVFELPDIHAGRSLLSDCIRKGLTVTRFEQKTESLEDVYLKVVHA

Atome Classification :

(30 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_A_3(4QC2)
?
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ATP_A_4(4P33)
LPTB_ECOLI
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_A_3(4YER)
?
[Raw transfer]




ADP_B_9(4HLU)
ECFA2_THEMA
[Raw transfer]




ADP_A_3(4P32)
LPTB_ECOLI
[Raw transfer]




ANP_A_6(4ZIR)
ECFA2_THEMA
[Raw transfer]




ADP_A_5(4HLU)
ECFA2_THEMA
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




65 HHSearch 81.6135% -10 - C1 -4YER 6.2 ?
2 PsiBlast_PDB 80.0234% -32 - C1 -4RVC - ? -
51 PsiBlast_CBE 78.7632% -33 - C1 -3FVQ - FBPC_NEIG1 -
50 PsiBlast_CBE 78.1332% -35 - C1 -3FVQ - FBPC_NEIG1 -
39 PsiBlast_CBE 77.8231% -23 - C1 -4U00 - ? -
11 PsiBlast_PDB 77.7330% -42 - C1 -4P32 6.2 LPTB_ECOLI
38 PsiBlast_CBE 76.9331% -27 - C1 -4U02 - ? -
35 PsiBlast_CBE 76.7731% -26 - C1 -4U02 - ? -
13 PsiBlast_PDB 76.4530% -33 - C1 -4QC2 7.0 ?
14 PsiBlast_PDB 76.4229% -37 - C1 -4P33 7.5 LPTB_ECOLI
37 PsiBlast_CBE 76.2931% -23 - C1 -4U02 - ? -
73 HHSearch 75.5727% -45 - C1 -3RLF - MALK_ECOLI -
47 PsiBlast_CBE 75.3832% -42 - C1 -4HLU - ECFA1_THEMA -
36 PsiBlast_CBE 75.2531% -28 - C1 -4U02 - ? -
41 PsiBlast_CBE 74.5234% -26 - C1 -4HLU 3.8 ECFA2_THEMA
42 PsiBlast_CBE 74.5034% -27 - C1 -4HLU 3.7 ECFA2_THEMA
66 HHSearch 72.8529% -47 - C1 -4TQU - ? -
69 HHSearch 72.5030% -35 - C1 -2IT1 - ? -
43 PsiBlast_CBE 71.9632% -44 - C1 -2ONK - WTPC_ARCFU -
71 HHSearch 71.9431% -21 - C1 -3FVQ - FBPC_NEIG1 -
26 PsiBlast_CBE 71.3132% 7 - C1 -3C4J 5.4 ?
24 PsiBlast_CBE 70.7732% -5 - C1 -4YMU 6.1 ?
7 PsiBlast_PDB 70.6732% -1 - C1 -4YMU 6.0 ?
23 PsiBlast_CBE 70.5832% -3 - C1 -4YMV 6.0 ?
25 PsiBlast_CBE 70.2132% 7 - C1 -3C41 5.9 ?
20 PsiBlast_PDB 68.9532% 8 - C1 -3C4J 6.5 ?
15 PsiBlast_PDB 66.8032% 8 - C1 -3C41 6.8 ?
33 PsiBlast_CBE 66.5132% 8 - C1 -2OLK 6.6 ?
31 PsiBlast_CBE 66.0832% 10 - C1 -2OLK 6.2 ?
40 PsiBlast_CBE 61.3334% -20 - C1 -4ZIR 3.5 ECFA2_THEMA