@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu38810: (2016-08-04 )
MAELRMEHIYKFYDQKEPAVDDFNLHIADKEFIVFVGPSGCGKSTTLRMVAGLEEISKGDFYIEGKRVNDVAPKDRDIAMVFQNYALYPHMTVYDNIAFGLKLRKMPKPEIKKRVEEAAKILGLEEYLHRKPKALSGGQRQRVALGRAIVRDAKVFLMDEPLSNLDAKLRVQMRAEIIKLHQRLQTTTIYVTHDQTEALTMATRIVVMKDGKIQQIGTPKDVYEFPENVFVGGFIGSPAMNFFKGKLTDGLIKIGSAALTVPEGKMKVLREKGYIGKEVIFGIRPEDIHDELIVVESYKNSSIKAKINVAELLGSEIMIYSQIDNQDFIARIDARLDIQSGDELTVAFDMNKGHFFDSETEVRIR

Atome Classification :

(47 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_J_5(3C41)
?
[Raw transfer]




ATP_B_6(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_A_6(4YMV)
?
[Raw transfer]




ATP_A_7(4YMU)
?
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_A_5(1L2T)
Y796_METJA
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




ATP_B_6(1L2T)
Y796_METJA
[Raw transfer]




AGS_B_6(3C4J)
?
[Raw transfer]




ANP_K_6(3C41)
?
[Raw transfer]




ADP_A_3(3TIF)
Y796_METJA
[Raw transfer]




ADP_B_9(4HLU)
ECFA2_THEMA
[Raw transfer]




ADP_B_6(2Q0H)
?
[Raw transfer]




ADP_B_8(3TIF)
Y796_METJA
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ADP_A_5(4HLU)
ECFA2_THEMA
[Raw transfer]




ADP_B_6(2OLJ)
?
[Raw transfer]




ANP_A_6(4ZIR)
ECFA2_THEMA
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




AT4_D_8(2OLK)
?
[Raw transfer]




AT4_B_6(2OLK)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




AT4_C_7(2OLK)
?
[Raw transfer]




7 PsiBlast_PDB 84.4648%-132 - C2 -1V43 - ? -
6 PsiBlast_PDB 83.9248%-129 - C2 -1VCI - ? -
95 HHSearch 82.9749%-116 - C2 -1V43 - ? -
4 PsiBlast_PDB 82.7751% -78 - C2 -4XIG - ? -
5 PsiBlast_PDB 81.9451% -79 - C2 -4XTC - ? -
3 PsiBlast_PDB 80.3751% -79 - C2 -4TQV - ? -
2 PsiBlast_PDB 80.3751% -79 - C2 -4TQU - ? -
94 HHSearch 79.7551% -79 - C2 -4TQU - ? -
100 HHSearch 78.0945% -86 - C2 -3RLF - MALK_ECOLI -
15 PsiBlast_PDB 78.0644% -85 - C2 -3PUZ - MALK_ECOLI -
17 PsiBlast_PDB 77.8344% -84 - C2 -3PUV - MALK_ECOLI -
19 PsiBlast_PDB 77.6044% -82 - C2 -3PUX - MALK_ECOLI -
1 PsiBlast_PDB 77.3153% 9 - C2 -2D62 - ? -
20 PsiBlast_PDB 76.8644% -83 - C2 -3RLF - MALK_ECOLI -
34 PsiBlast_CBE 76.5044% -77 - C2 -2R6G - MALK_ECOLI (first) -
18 PsiBlast_PDB 76.4144% -80 - C2 -3PUW - MALK_ECOLI -
22 PsiBlast_CBE 76.1844% -82 - C2 -4KI0 - MALK_ECOLI -
21 PsiBlast_CBE 75.9344% -82 - C2 -4KI0 - MALK_ECOLI -
14 PsiBlast_PDB 75.8044% -80 - C2 -3PUY - MALK_ECOLI -
16 PsiBlast_PDB 75.7844% -76 - C2 -3PV0 - MALK_ECOLI -
49 PsiBlast_CBE 47.7237% -24 - C2 -3FVQ 7.4 FBPC_NEIG1
50 PsiBlast_CBE 47.0337% -19 - C2 -3FVQ 6.9 FBPC_NEIG1
101 HHSearch 46.0230% -6 - C2 -3FVQ 7.7 FBPC_NEIG1
78 PsiBlast_CBE 45.0734% -15 - C2 -4YMV 5.3 ?
59 PsiBlast_CBE 44.3335% -7 - C2 -3C4J 3.2 ?
79 PsiBlast_CBE 44.1634% -11 - C2 -4YMV 4.7 ?
58 PsiBlast_CBE 43.7735% -14 - C2 -3C41 5.1 ?
57 PsiBlast_CBE 43.4935% -18 - C2 -3C41 3.6 ?
67 PsiBlast_CBE 42.9035% -11 - C2 -2OLK 4.0 ?
69 PsiBlast_CBE 42.8435% -10 - C2 -2OLK 3.8 ?
70 PsiBlast_CBE 42.4935% -14 - C2 -2OLK 3.7 ?
60 PsiBlast_CBE 42.3535% -8 - C2 -3C4J 4.7 ?
61 PsiBlast_CBE 42.3435% -14 - C2 -2Q0H 3.6 ?
84 PsiBlast_CBE 42.2733% 20 - C2 -3TIF 6.2 Y796_METJA
71 PsiBlast_CBE 41.9235% -9 - C2 -2OLJ 3.6 ?
77 PsiBlast_CBE 41.9131% -25 - C2 -4U00 6.0 ?
85 PsiBlast_CBE 41.8433% 22 - C2 -3TIF 5.9 Y796_METJA
80 PsiBlast_CBE 41.7634% -14 - C2 -4YMU 5.5 ?
72 PsiBlast_CBE 41.6935% -5 - C2 -2OLJ 3.9 ?
68 PsiBlast_CBE 41.5635% -14 - C2 -2OLK 4.2 ?
81 PsiBlast_CBE 41.3434% -16 - C2 -4YMU 5.7 ?
62 PsiBlast_CBE 40.6835% -10 - C2 -2Q0H 3.3 ?
82 PsiBlast_CBE 40.5433% 27 - C2 -1L2T 6.7 Y796_METJA
83 PsiBlast_CBE 40.3233% 26 - C2 -1L2T 6.4 Y796_METJA
89 PsiBlast_CBE 39.3132% -14 - C2 -4HLU 3.2 ECFA2_THEMA
88 PsiBlast_CBE 39.2532% -16 - C2 -4HLU 3.6 ECFA2_THEMA
90 PsiBlast_CBE 36.0032% -15 - C2 -4ZIR 3.5 ECFA2_THEMA