@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu38970: (2016-08-04 )
MRKQVALVTGAAGGIGFEIAREFAREGASVIVSDLRPEACEKAASKLAEEGFDAAAIPYDVTKEAQVADTVNVIQKQYGRLDILVNNAGIQHVAPIEEFPTDTFEQLIKVMLTAPFIAMKHVFPIMKKQQFGRIINIASVNGLVGFAGKSAYNSAKHGVIGLTKVGALEGAPHGITVNALCPGYVDTQLVRNQLSDLSKTRNVPYDSVLEQVIFPLVPQKRLLSVKEIADYAVFLASEKAKGVTGQAVVLDGGYTAQ

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DXX_A_3(3W8D)
?
[Raw transfer]




3HR_A_3(3W8E)
?
[Raw transfer]




3HR_D_24(3VDR)
?
[Raw transfer]




3HL_A_6(2ZTL)
?
[Raw transfer]




3HR_C_19(3VDR)
?
[Raw transfer]




MLA_A_3(3W8F)
?
[Raw transfer]




3HL_D_14(2ZTL)
?
[Raw transfer]




3HL_A_6(2ZTM)
?
[Raw transfer]




3HL_C_12(2ZTL)
?
[Raw transfer]




3HL_B_9(2ZTL)
?
[Raw transfer]




3HR_A_9(3VDR)
?
[Raw transfer]




3HR_B_15(3VDR)
?
[Raw transfer]




48 PsiBlast_CBE 88.3640%-115 - C1 -2Q2V - ? -
49 PsiBlast_CBE 87.7840%-110 - C1 -2Q2V - ? -
51 PsiBlast_CBE 86.6340%-113 - C1 -2Q2Q - ? -
53 PsiBlast_CBE 85.5140%-113 - C1 -2Q2Q - ? -
16 PsiBlast_PDB 85.4340%-120 - C1 -2Q2W - ? -
14 PsiBlast_PDB 84.5540%-118 - C1 -2Q2Q - ? -
47 PsiBlast_CBE 83.7740%-117 - C1 -2Q2V - ? -
54 PsiBlast_CBE 83.5840%-110 - C1 -2Q2Q - ? -
3 PsiBlast_PDB 83.5542% -26 - C1 -3VDQ - ? -
55 PsiBlast_CBE 83.5440%-122 - C1 -2Q2Q - ? -
15 PsiBlast_PDB 83.1340%-117 - C1 -2Q2V - ? -
6 PsiBlast_PDB 82.5242% -25 - C1 -3W8F 3.8 ?
50 PsiBlast_CBE 82.0540%-116 - C1 -2Q2Q - ? -
1 PsiBlast_PDB 81.9842% -32 - C1 -2YZ7 - ? -
35 PsiBlast_CBE 81.8743% -25 - C1 -2ZTV - ? -
33 PsiBlast_CBE 81.5542% -28 - C1 -2YZ7 - ? -
25 PsiBlast_CBE 81.3642% -31 - C1 -3VDQ - ? -
2 PsiBlast_PDB 81.0242% -22 - C1 -3VDR 2.9 ?
32 PsiBlast_CBE 81.0042% -34 - C1 -2YZ7 - ? -
37 PsiBlast_CBE 80.8843% -20 - C1 -2ZTL 3.2 ?
9 PsiBlast_PDB 80.7843% -19 - C1 -2ZTL 3.0 ?
21 PsiBlast_CBE 80.6942% -24 - C1 -3VDR 2.6 ?
39 PsiBlast_CBE 80.6343% -21 - C1 -2ZTL 2.9 ?
38 PsiBlast_CBE 80.4943% -22 - C1 -2ZTL 3.0 ?
4 PsiBlast_PDB 80.3742% -27 - C1 -3W8D 4.2 ?
5 PsiBlast_PDB 80.3642% -26 - C1 -3W8E 3.8 ?
22 PsiBlast_CBE 79.0142% -22 - C1 -3VDR 3.0 ?
12 PsiBlast_PDB 78.2643% -19 - C1 -2ZTM 3.0 ?
23 PsiBlast_CBE 77.3542% -27 - C1 -3VDR 3.2 ?