@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu39110: (2016-08-05 )
MSHFKNYQISHDILRALEGLGYTEPTKVQQSVIPAALERKDLVVKSQTGSGKTASFGIPLCELANWDENKPQALILTPTRELAVQVKEDITNIGRFKRIKATAVFGKSSFDKQKAELKQKSHIVVGTPGRVLDHIEKGTLPLDRLSYLVIDEADEMLNMGFIEQVEAIIKHLPTERTTMLFSATLPQDIEKLSRQYMQNPEHIEVKAAGLTTRNIEHAVIQVREENKFSLLKDVLMTENPDSCIIFCRTKEHVNQLTDELDDLGYPCDKIHGGMIQEDRFDVMNEFKRGEYRYLVATDVAARGIDIENISLVINYDLPLEKESYVHRTGRTGRAGNKGKAISFVTAFEKRFLADIEEYIGFEIQKIEAPSQEEVARKKPEFLAKLNDRPESKKDKSEELNKDIMKLYFNGGKKKKIRAVDFVGTIAKIDGVSADDIGIITIMDNASYVEILNGKGPHVLKVMKNTTVKGKQLKVNKANK

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ANP_A_2(5E7M)
DDX3X_HUMAN
[Raw transfer]




ANP_A_7(3FHT)
DD19B_HUMAN
[Raw transfer]




ANP_A_3(4D25)
?
[Raw transfer]




ANP_A_7(3FHT)
DD19B_HUMAN
[Raw transfer]




ANP_B_12(3FHT)
DD19B_HUMAN
[Raw transfer]




M2A_A_3(5ELX)
?
[Raw transfer]




ANP_A_3(3G0H)
DD19B_HUMAN
[Raw transfer]




ADP_A_3(3PEY)
DBP5_YEAST
[Raw transfer]




ANP_A_3(3SQW)
MS116_YEAST
[Raw transfer]




ADP_A_3(3PEW)
DBP5_YEAST
[Raw transfer]




ADP_A_3(3PEY)
DBP5_YEAST
[Raw transfer]




8OP_C_10(3NBF)
?
[Raw transfer]




ANP_A_3(4D25)
?
[Raw transfer]




ADP_A_4(3FE2)
DDX5_HUMAN
[Raw transfer]




ANP_A_7(2J0S)
IF4A3_HUMAN
[Raw transfer]




ADP_A_4(4PX9)
DDX3X_HUMAN
[Raw transfer]




ADP_B_5(4PX9)
DDX3X_HUMAN
[Raw transfer]




ANP_A_3(3I5X)
MS116_YEAST
[Raw transfer]




ADP_A_2(4LJY)
PRP5_YEAST
[Raw transfer]




ANP_B_4(3B7G)
DDX20_HUMAN
[Raw transfer]




ANP_A_3(3B7G)
DDX20_HUMAN
[Raw transfer]




ADP_A_3(4D26)
?
[Raw transfer]




ADP_C_6(4PX9)
DDX3X_HUMAN
[Raw transfer]




ADP_B_8(3FE2)
DDX5_HUMAN
[Raw transfer]




ADP_A_2(4PXA)
DDX3X_HUMAN
[Raw transfer]




ADP_B_4(2OXC)
DDX20_HUMAN
[Raw transfer]




ADP_A_3(2PL3)
DDX10_HUMAN
[Raw transfer]




AMP_A_2(2GXQ)
?
[Raw transfer]




8OX_B_6(3MWL)
?
[Raw transfer]




ADP_B_4(3FMO)
DD19B_HUMAN
[Raw transfer]




AMP_A_2(2I4I)
DDX3X_HUMAN
[Raw transfer]




ADP_A_3(2OXC)
DDX20_HUMAN
[Raw transfer]




ADP_A_2(4PXA)
DDX3X_HUMAN
[Raw transfer]




AMP_A_2(5E7J)
DDX3X_HUMAN
[Raw transfer]




AMP_A_8(2GXS)
?
[Raw transfer]




AMP_B_9(2GXS)
?
[Raw transfer]




AMP_A_2(2I4I)
DDX3X_HUMAN
[Raw transfer]




8OD_A_5(3NBF)
?
[Raw transfer]




ADP_A_3(3RRN)
DBP5_YEAST
[Raw transfer]




8OP_B_6(3MWK)
?
[Raw transfer]




AMP_A_3(3BER)
DDX47_HUMAN
[Raw transfer]




AMP_B_6(2VSO)
IF4A_YEAST
[Raw transfer]




AMP_A_5(2VSX)
IF4A_YEAST
[Raw transfer]




AMP_A_3(4KBF)
?
[Raw transfer]




AMP_A_3(4KBF)
?
[Raw transfer]




ADP_A_3(3EWS)
DD19B_HUMAN
[Raw transfer]




AMP_B_6(2VSX)
IF4A_YEAST
[Raw transfer]




AMP_A_5(2VSO)
IF4A_YEAST
[Raw transfer]




FLC_D_4(1T6N)
DX39B_HUMAN
[Raw transfer]




FLC_C_3(1T6N)
DX39B_HUMAN
[Raw transfer]




1PE_A_4(4BRW)
DHH1_YEAST
[Raw transfer]




IPA_D_4(1XTI)
DX39B_HUMAN
[Raw transfer]




24 PsiBlast_CBE 80.6939% -73 - C1 -2HYI - IF4A3_HUMAN -
28 PsiBlast_CBE 80.5138% -88 - C1 -2VSO 4.8 IF4A_YEAST
17 PsiBlast_PDB 80.2538% -87 - C1 -2VSO 4.3 IF4A_YEAST
5 PsiBlast_PDB 80.2439% -77 - C1 -2HYI - IF4A3_HUMAN -
3 PsiBlast_PDB 80.0739% -76 - C1 -2J0S 8.4 IF4A3_HUMAN
6 PsiBlast_PDB 80.0239% -78 - C1 -3EX7 - IF4A3_HUMAN -
27 PsiBlast_CBE 79.8238% -86 - C1 -2VSX 3.4 IF4A_YEAST
122 HHSearch 79.7335%-126 - C1 -1S2M - DHH1_YEAST -
4 PsiBlast_PDB 79.7139% -75 - C1 -2XB2 - IF4A3_HUMAN -
18 PsiBlast_PDB 79.6238% -85 - C1 -2VSX 3.4 IF4A_YEAST
22 PsiBlast_CBE 79.6039% -76 - C1 -2XB2 - IF4A3_HUMAN -
21 PsiBlast_CBE 79.3739% -73 - C1 -2J0Q - IF4A3_HUMAN -
26 PsiBlast_CBE 79.2342% -25 - C1 -4KBF - ? -
2 PsiBlast_PDB 78.9639% -72 - C1 -2J0Q - IF4A3_HUMAN -
31 PsiBlast_CBE 78.6634%-130 - C1 -4BRW 1.6 DHH1_YEAST
23 PsiBlast_CBE 78.2739% -73 - C1 -3EX7 - IF4A3_HUMAN -
8 PsiBlast_PDB 78.0439% -77 - C1 -2J0U - IF4A3_HUMAN -
25 PsiBlast_CBE 76.8742% -18 - C1 -4KBG - ? -
7 PsiBlast_PDB 76.5539% -82 - C1 -2HXY - IF4A3_HUMAN -
19 PsiBlast_PDB 76.2035% -40 - C1 -4CT4 - DDX6_HUMAN -
10 PsiBlast_PDB 75.9542% -16 - C1 -4KBF 5.3 ?
131 HHSearch 74.9742% -15 - C1 -4KBF 5.3 ?
118 HHSearch 74.8040% -2 - C1 -4PXA 5.0 DDX3X_HUMAN
135 HHSearch 74.4240% 13 - C1 -2I4I 6.1 DDX3X_HUMAN
16 PsiBlast_PDB 73.2140% -7 - C1 -4PXA 5.0 DDX3X_HUMAN
12 PsiBlast_PDB 72.4840% 13 - C1 -2I4I 6.1 DDX3X_HUMAN
14 PsiBlast_PDB 72.3840% 8 - C1 -5E7J 6.2 DDX3X_HUMAN
15 PsiBlast_PDB 71.8740% 4 - C1 -5E7M 5.0 DDX3X_HUMAN
119 HHSearch 70.2134% 1 - C1 -4D25 9.7 ?
44 PsiBlast_CBE 68.7131% -15 - C1 -1XTI 3.8 DX39B_HUMAN
39 PsiBlast_CBE 66.8331% 2 - C1 -3RRN 3.1 DBP5_YEAST
130 HHSearch 66.8230% 18 - C1 -4LJY 5.7 PRP5_YEAST
41 PsiBlast_CBE 65.1831% 3 - C1 -3PEW 7.1 DBP5_YEAST
51 PsiBlast_CBE 65.1532% 17 - C1 -3FHT 7.3 DD19B_HUMAN
37 PsiBlast_CBE 64.8035% 11 - C1 -4D25 9.5 ?
42 PsiBlast_CBE 64.7831% 3 - C1 -3PEY 5.9 DBP5_YEAST
43 PsiBlast_CBE 64.4031% 4 - C1 -5ELX 7.5 ?
36 PsiBlast_CBE 63.9135% 7 - C1 -4D26 7.1 ?
53 PsiBlast_CBE 63.7832% 26 - C1 -3EWS 3.3 DD19B_HUMAN
52 PsiBlast_CBE 62.9232% 15 - C1 -3FHT 6.6 DD19B_HUMAN
133 HHSearch 62.5832% 0 - C1 -3PEY 5.8 DBP5_YEAST
54 PsiBlast_CBE 62.1032% 17 - C1 -3G0H 6.9 DD19B_HUMAN
134 HHSearch 61.8730% 14 - C1 -3SQW 9.2 MS116_YEAST
127 HHSearch 60.7532% 28 - C1 -3FHT 6.6 DD19B_HUMAN
128 HHSearch 60.6430% 14 - C1 -3I5X 6.8 MS116_YEAST
48 PsiBlast_CBE 58.4347% -41 - C1 -2GXQ 6.3 ?
81 PsiBlast_CBE 58.2732% -66 - C1 -1T6N 2.5 DX39B_HUMAN
46 PsiBlast_CBE 57.5147% -32 - C1 -2GXS 5.0 ?
90 PsiBlast_CBE 57.2632% -63 - C1 -2OXC 6.4 DDX20_HUMAN
65 PsiBlast_CBE 57.2639% -64 - C1 -3BER 4.5 DDX47_HUMAN
47 PsiBlast_CBE 56.9147% -34 - C1 -2GXS 5.2 ?
80 PsiBlast_CBE 56.8632% -63 - C1 -1T6N 2.9 DX39B_HUMAN
58 PsiBlast_CBE 56.8346% -30 - C1 -3NBF 4.0 ?
61 PsiBlast_CBE 56.4546% -42 - C1 -3MWK 4.0 ?
88 PsiBlast_CBE 56.3132% -61 - C1 -3B7G 5.0 DDX20_HUMAN
91 PsiBlast_CBE 56.2532% -60 - C1 -2OXC 6.4 DDX20_HUMAN
89 PsiBlast_CBE 56.2432% -59 - C1 -3B7G 5.2 DDX20_HUMAN
56 PsiBlast_CBE 56.1146% -35 - C1 -3NBF 4.5 ?
59 PsiBlast_CBE 54.9146% -39 - C1 -3MWL 5.2 ?
71 PsiBlast_CBE 54.7737% -21 - C1 -4PX9 5.5 DDX3X_HUMAN
70 PsiBlast_CBE 54.4237% -21 - C1 -4PX9 5.3 DDX3X_HUMAN
72 PsiBlast_CBE 54.3737% -21 - C1 -4PX9 5.6 DDX3X_HUMAN
95 PsiBlast_CBE 52.2033% -15 - C1 -3FMO 5.7 DD19B_HUMAN
73 PsiBlast_CBE 50.2234% 3 - C1 -3FE2 6.2 DDX5_HUMAN
74 PsiBlast_CBE 49.1934% 7 - C1 -3FE2 3.3 DDX5_HUMAN
77 PsiBlast_CBE 46.7935% -1 - C1 -2PL3 6.2 DDX10_HUMAN