@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu39330: (2016-08-05 )
MFNRLFRVCFLAALIMAFTLPNSVYAQKPIFKEVSVHDPSIIETNGTFYVFGSHLASAKSNDLMQWQQLTTSVSNDNPLIPNVYEELKETFEWAQSDTLWAADVTQLADGKYYMYYNACRGDSPRSAMGVAVADNIEGPYKNKGIFLKSGMEGTSSDGTPYDATKHPNVVDPHTFFDKDGKLWMVYGSYSGGIFILEMNPKTGFPLPGQGYGKKLLGGNHSRIEGPYVLYNPDTQYYYLYLSYGGLDATGGYNIRVARSKKPDGPYYDAEGNPMLDVRGKGGTFFDDRSIEPYGVKLMGSYTFETENEKGTGYVSPGHNSAYYDEKTGRSYLIFHTRFPGRGEEHEVRVHQLFMNKDGWPVAAPYRYAGETLKEVKQKDITGTYKLIQHGKDISADIKQTINIQLNKNHTISGEMTGTWRKTGKNTADITLAGKKYNGVFLRQWDSVREKNVMTFSVLNTSGEAVWGSK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_A_3(4COT)
EABN2_BACSU
[Raw transfer]




SUGAR_B_10(2X8S)
EABN2_BACSU
[Raw transfer]

-

TRS_B_13(2X8F)
EABN2_BACSU
[Raw transfer]




SUGAR_A_3(2X8S)
EABN2_BACSU
[Raw transfer]

-

SUGAR_A_3(2X8S)
EABN2_BACSU
[Raw transfer]

-

TRS_B_9(2X8T)
EABN2_BACSU
[Raw transfer]




GOL_A_3(3CU9)
IABN_GEOSE
[Raw transfer]




MPD_A_12(2X8F)
EABN2_BACSU
[Raw transfer]




MPD_A_5(2X8T)
EABN2_BACSU
[Raw transfer]




22 PsiBlast_CBE 92.5499% -61 - C1 -2X8S 5.3 EABN2_BACSU
73 HHSearch 91.71100% -59 - C1 -2X8S 5.5 EABN2_BACSU
21 PsiBlast_CBE 91.66100% -61 - C1 -2X8F 3.0 EABN2_BACSU
4 PsiBlast_PDB 91.5799% -60 - C1 -2X8T 3.2 EABN2_BACSU
2 PsiBlast_PDB 91.5199% -59 - C1 -2X8S 5.5 EABN2_BACSU
23 PsiBlast_CBE 91.3699% -59 - C1 -2X8T 3.0 EABN2_BACSU
1 PsiBlast_PDB 91.35100% -60 - C1 -2X8F 3.1 EABN2_BACSU
3 PsiBlast_PDB 90.4599% -56 - C1 -4COT 3.0 EABN2_BACSU
5 PsiBlast_PDB 82.8773% -62 - C1 -3LV4 - ? -
74 HHSearch 69.6454% 18 - C1 -4KC7 - EABN_THEP1 -
6 PsiBlast_PDB 69.6052% 22 - C1 -4KC7 - EABN_THEP1 -
26 PsiBlast_CBE 69.2852% 22 - C1 -4KC7 - EABN_THEP1 -
7 PsiBlast_PDB 69.2752% 23 - C1 -4KC8 - EABN_THEP1 -
24 PsiBlast_CBE 69.0752% 22 - C1 -4KC8 - EABN_THEP1 -
25 PsiBlast_CBE 68.9952% 10 - C1 -4KC7 - EABN_THEP1 -
75 HHSearch 56.4240% 39 - C1 -4KCA - ? -
8 PsiBlast_PDB 55.6735% 44 - C1 -4KCA - ? -
27 PsiBlast_CBE 55.0235% 44 - C1 -4KCA - ? -
9 PsiBlast_PDB 45.9325% -2 - C1 -3CU9 2.5 IABN_GEOSE
14 PsiBlast_PDB 45.7025% -4 - C1 -3D5Y - IABN_GEOSE -