@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu39480: (2016-08-05 )
MITVKNIRKAFKDLVVLDGIDLEVKRGEVVAIIGPSGSGKSTLLRCLNLLERPDQGLIEIGEAKLNAEKFTRKEAHRLRQQTAMVFQNYNLFKNKTALQNITEALIVAQHKPRDEAKRIGMEILKQVGLEHKADSYPITMSGGQQQRIGIARALAVNPHAILLDEPTSALDPELVTGVLQVIKSIAEKQTTMIIVTHEMAFAKEVADQVIFMADGHIIEQGTPEELFDHPKNERTKRFIKQVGEPAELI

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_H_8(2FGK)

[Raw transfer]




ATP_E_5(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_J_5(4YMU)
?
[Raw transfer]




ATP_F_6(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_H_8(2FGJ)

[Raw transfer]




ATP_G_7(2FGK)
HLYBP_ECOLX
[Raw transfer]




ATP_E_5(2FGK)
HLYBP_ECOLX
[Raw transfer]




12D_A_2(3B5J)

[Raw transfer]




ATP_F_6(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




128_A_2(2PMK)

[Raw transfer]




ATP_G_7(2FGJ)
HLYBP_ECOLX
[Raw transfer]




ADP_B_2(2FF7)

[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




LMT_A_7(4MKI)
ECFA2_CALS4
[Raw transfer]




LMT_B_4(4MKI)
ECFA2_CALS4
[Raw transfer]




29 PsiBlast_CBE 93.8852%-124 - C1 -2OLK - ? -
9 PsiBlast_PDB 93.5152%-129 - C1 -2OUK - ? -
7 PsiBlast_PDB 92.8852%-131 - C1 -2OLJ - ? -
128 HHSearch 92.8453%-130 - C1 -2OLJ 6.0 ?
8 PsiBlast_PDB 92.7052%-127 - C1 -2OLK - ? -
22 PsiBlast_CBE 92.2452%-128 - C1 -4YMU - ? -
31 PsiBlast_CBE 91.9052%-123 - C1 -2OLK - ? -
131 HHSearch 91.7854%-119 - C1 -4YMU 6.6 ?
27 PsiBlast_CBE 91.5652%-124 - C1 -2OUK - ? -
30 PsiBlast_CBE 90.9052%-127 - C1 -2OLK - ? -
3 PsiBlast_PDB 90.3552%-123 - C1 -4YMU - ? -
23 PsiBlast_CBE 90.1752%-125 - C1 -3C41 - ? -
24 PsiBlast_CBE 89.9952%-126 - C1 -3C4J - ? -
10 PsiBlast_PDB 89.6952%-121 - C1 -2Q0H - ? -
5 PsiBlast_PDB 89.4852%-122 - C1 -4YMW - ? -
26 PsiBlast_CBE 89.3752%-121 - C1 -2OUK - ? -
1 PsiBlast_PDB 89.3752%-125 - C1 -4YMS - ? -
6 PsiBlast_PDB 89.0452%-117 - C1 -3C41 - ? -
11 PsiBlast_PDB 89.0352%-121 - C1 -3C4J - ? -
28 PsiBlast_CBE 88.2752%-125 - C1 -2OUK - ? -
127 HHSearch 82.3548%-116 - C1 -4U00 6.0 ?
117 HHSearch 54.2232%-107 - C1 -3FVQ 6.7 FBPC_NEIG1
98 PsiBlast_CBE 47.5236% -13 - C1 -4MKI 2.0 ECFA2_CALS4
60 PsiBlast_CBE 47.0732% -45 - C1 -1VCI 4.0 ?
101 PsiBlast_CBE 44.2235% 4 - C1 -2FGJ 6.9 HLYBP_ECOLX
100 PsiBlast_CBE 43.7835% 3 - C1 -2FGJ 6.2 HLYBP_ECOLX
97 PsiBlast_CBE 43.3536% -17 - C1 -4MKI 2.2 ECFA2_CALS4
99 PsiBlast_CBE 42.5035% -2 - C1 -2FGJ 6.5
91 PsiBlast_CBE 42.2135% 5 - C1 -2FGK 6.6
96 PsiBlast_CBE 41.8835% -2 - C1 -3B5J 6.3
93 PsiBlast_CBE 40.4935% 4 - C1 -2FGK 6.6 HLYBP_ECOLX
90 PsiBlast_CBE 40.4335% 1 - C1 -2PMK 6.6
94 PsiBlast_CBE 40.3835% 5 - C1 -2FGK 7.1 HLYBP_ECOLX
102 PsiBlast_CBE 39.7635% 3 - C1 -2FGJ 6.8 HLYBP_ECOLX
88 PsiBlast_CBE 38.0335% 2 - C1 -2FF7 6.1
92 PsiBlast_CBE 37.4035% 8 - C1 -2FGK 6.7 HLYBP_ECOLX