@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu40000: (2016-08-06 )
MTIDHSVTNTEQLEQQNPAIKTKLKLKKLKDQVIVITGASSGIGLVTARMAAEKGAKVVAAARNEEALKELTDELKEKGHDAIWVKADVGKEEDVNRIAETAISTFGRFDTWVNNAAVSTFGHAMDVTVEDMKRMFDTNFWGPVYGTRAAVKHYTGRGVPGALINVGSLFGDRGTVIQSTYASAKFALHGWTESIRMELEKEQAPVSVTLIHPGRIDTPYNEHAHSYLDKQPAHYRSMIYPPEAVAEAILFAAEHPKRDMYIGSQAKAIAMLGALFPRLTDRLMEKIMYHSQHAERPSNPREESALYDAGCGMHDRGTNKGWMRSRSYYTKATKRPIVSAAVVAGLVAWAAAKRCR

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAI_B_9(3AY6)
DHG4_BACME
[Raw transfer]




NAI_A_5(3AY6)
DHG4_BACME
[Raw transfer]




NAI_C_11(3AY6)
DHG4_BACME
[Raw transfer]




NDP_B_7(2JAP)
?
[Raw transfer]




NAD_M_13(1GCO)
DHG_BACME
[Raw transfer]




NDP_A_5(2JAP)
?
[Raw transfer]




NAD_I_9(1GEE)
DHG_BACME
[Raw transfer]




NDP_D_11(2JAP)
?
[Raw transfer]




NDP_C_9(2JAP)
?
[Raw transfer]




NAI_D_14(3AY6)
DHG4_BACME
[Raw transfer]




NAD_K_11(1GCO)
DHG_BACME
[Raw transfer]




MPD_A_21(4H15)
?
[Raw transfer]




50 PsiBlast_CBE 85.6434% -99 - C2 -2JAP 12.6 ?
49 PsiBlast_CBE 85.5734% -98 - C2 -2JAP 12.8 ?
51 PsiBlast_CBE 85.3734% -98 - C2 -2JAP 12.6 ?
20 PsiBlast_PDB 85.3634% -97 - C2 -2JAP 12.5 ?
98 HHSearch 83.8229% -83 - C2 -3WDS - ? -
74 PsiBlast_CBE 83.4131% -88 - C2 -3WYE - BUDC_CORGT (first) -
73 PsiBlast_CBE 80.6831% -94 - C2 -3WYE - BUDC_CORGT (first) -
23 PsiBlast_CBE 80.0132% -79 - C2 -4NBU - ? -
43 PsiBlast_CBE 79.9234%-118 - C2 -2EHD - ? -
55 PsiBlast_CBE 78.1232% -58 - C2 -3TOX - ? -
22 PsiBlast_CBE 77.7632% -82 - C2 -4NBU - ? -
1 PsiBlast_PDB 77.6332% -81 - C2 -4NBU - ? -
53 PsiBlast_CBE 77.5632% -58 - C2 -3TOX - ? -
52 PsiBlast_CBE 77.3832% -60 - C2 -3TOX - ? -
57 PsiBlast_CBE 77.1632% -60 - C2 -3TOX - ? -
42 PsiBlast_CBE 77.0436% 0 - C- -4MOW - ? -
21 PsiBlast_CBE 76.7232% -81 - C2 -4NBU - ? -
56 PsiBlast_CBE 76.6932% -58 - C2 -3TOX - ? -
59 PsiBlast_CBE 76.5532% -62 - C2 -3TOX - ? -
14 PsiBlast_PDB 76.3834%-110 - C2 -2EHD - ? -
26 PsiBlast_CBE 75.1834% -16 - C2 -3AY6 3.3 DHG4_BACME
3 PsiBlast_PDB 74.8534% -14 - C2 -3AY6 4.3 DHG4_BACME
92 HHSearch 74.4531% -18 * C2 *1GEE 4.8 DHG_BACME
27 PsiBlast_CBE 73.6134% -13 - C2 -3AY6 4.1 DHG4_BACME
25 PsiBlast_CBE 72.0534% -13 - C2 -3AY6 3.3 DHG4_BACME
34 PsiBlast_CBE 68.2634% -13 - C2 -1GCO 4.4 DHG_BACME
35 PsiBlast_CBE 67.5834% -12 - C2 -1GCO 4.2 DHG_BACME