@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu40250: (2016-08-07 )
MGGMALTGNKAVVYKGKGTVAVEDIGYPELILRDGPGVPKANVNRKCEHGVILKVITTNICGSDQHMVRGRTTAPEGLVLGHEITGEVIETGRDVEFIKKGDIVSVPFNIACGRCVMCKTQKTHVCLNVNPDRPGSAYGYVDMGGWVGGQSEYVMVPYADFQLLVFPDKEQALEKILDLTMLSDIFPTGFHGAYTAGVQTGSTVYIAGAGPVGLAAAHSAQLLGASTVIVGDLNEDRLAQARSFGCETVNVQKHDRLGEQIEQILGEPTVDAAVDCVGFEASGHGNQGEAPAAVLNSIMDVTQVGGSLGIPGLYVTEDPGAKDADAKTGSLKIRFGLGWAKAHTFVTGQTPAMTYNRNLMKAILSGRAQIAKAVNATVISLDDAPKGYSDFDKGAAKKFVIDPHGTLK

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_9(1KOL)
FADH_PSEPU
[Raw transfer]




NAD_A_9(1KOL)
FADH_PSEPU
[Raw transfer]




NAD_A_9(1KOL)
FADH_PSEPU
[Raw transfer]




NAD_B_10(1KOL)
FADH_PSEPU
[Raw transfer]




NAD_A_7(2DPH)
FDM_PSEPU
[Raw transfer]




NAD_B_8(2DPH)
FDM_PSEPU
[Raw transfer]




NAD_B_8(2EJV)
TDH_THET8
[Raw transfer]




NAD_B_8(1CDO)
ADH1_GADMC
[Raw transfer]




MES_A_7(2DQ4)
TDH_THET8
[Raw transfer]




NAD_A_7(2EJV)
TDH_THET8
[Raw transfer]




MES_B_8(2DQ4)
TDH_THET8
[Raw transfer]




23 PsiBlast_CBE 98.1566% -83 - C1 -4JLW - ? -
22 PsiBlast_CBE 98.0766% -84 - C1 -4JLW - ? -
21 PsiBlast_CBE 97.9166% -83 - C1 -4JLW - ? -
73 Fugue 97.5867% -80 - C1 -1KOL 12.4 FADH_PSEPU
24 PsiBlast_CBE 97.4966% -80 - C1 -1KOL 12.5 FADH_PSEPU
1 PsiBlast_PDB 97.4066% -82 * C1 *4JLW - ? -
2 PsiBlast_PDB 96.2866% -77 - C1 -1KOL 12.3 FADH_PSEPU
82 HHSearch 82.2667% -33 - C1 -1KOL 11.7 FADH_PSEPU
3 PsiBlast_PDB 79.5754% -24 - C1 -2DPH 11.4 FDM_PSEPU
25 PsiBlast_CBE 78.7954% -25 - C1 -2DPH 11.8 FDM_PSEPU
98 HHSearch 70.9952% -17 - C1 -2DPH - FDM_PSEPU -
89 HHSearch 59.4126% -83 - C1 -4EJ6 - ? -
4 PsiBlast_PDB 57.4029% -40 - C1 -4CPD - ? -
87 HHSearch 47.6025% -40 - C1 -1E3I - ADH4_MOUSE -
77 Fugue 46.1825% -38 - C1 -1TEH - ADHX_HUMAN -
95 HHSearch 44.9822% -22 - C1 -1F8F - ? -
97 HHSearch 44.7524% -6 - C1 -4RQT - ADH1_ARATH -
91 HHSearch 44.5724% -14 - C1 -3UKO - ADHX_ARATH -
83 HHSearch 42.8524% -25 - C1 -1JVB - ADH_SULSO -
99 HHSearch 42.1724% -20 - C1 -2FZW - ADHX_HUMAN -
53 PsiBlast_CBE 33.5531% -22 - C1 -1CDO 3.5 ADH1_GADMC
26 PsiBlast_CBE 29.1631% -42 - C1 -2EJV 7.0 TDH_THET8
8 PsiBlast_PDB 28.9431% -45 - C1 -2EJV 5.7 TDH_THET8
7 PsiBlast_PDB 28.5231% -44 - C1 -2DQ4 3.2 TDH_THET8
27 PsiBlast_CBE 26.4831% -44 - C1 -2DQ4 3.0 TDH_THET8