@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu40320: (2016-08-07 )
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKNDEELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYDAHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGERKYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVVGGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL

Atome Classification :

(74 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HAR_A_5(3LP7)
ARGI1_HUMAN
[Raw transfer]




NNH_A_5(3KV2)
ARGI1_HUMAN
[Raw transfer]




ABH_A_7(2AEB)
ARGI1_HUMAN
[Raw transfer]




ABH_B_8(2AEB)
ARGI1_HUMAN
[Raw transfer]




ABH_B_8(2PLL)
ARGI1_HUMAN
[Raw transfer]




NNH_B_8(3KV2)
ARGI1_HUMAN
[Raw transfer]




ABH_A_7(2AEB)
ARGI1_HUMAN
[Raw transfer]




ABH_A_7(2PLL)
ARGI1_HUMAN
[Raw transfer]




S2C_A_8(1WVA)
ARGI1_HUMAN
[Raw transfer]




ABH_A_6(4GWD)
ARGI1_HUMAN
[Raw transfer]




ABH_A_5(4GSV)
ARGI1_HUMAN
[Raw transfer]




ABH_A_7(4GSZ)
ARGI1_HUMAN
[Raw transfer]




ABH_A_5(3THH)
ARGI1_HUMAN
[Raw transfer]




ABH_B_8(4GSV)
ARGI1_HUMAN
[Raw transfer]




4U7_A_5(3SKK)
ARGI1_HUMAN
[Raw transfer]




5AB_A_5(3SJT)
ARGI1_HUMAN
[Raw transfer]




ABH_B_10(4GWD)
ARGI1_HUMAN
[Raw transfer]




5AB_B_8(3SJT)
ARGI1_HUMAN
[Raw transfer]




1EC_A_3(4IE1)
ARGI1_HUMAN
[Raw transfer]




S2C_B_7(1WVA)
ARGI1_HUMAN
[Raw transfer]




ABH_A_4(4IU0)
?
[Raw transfer]




ABH_B_6(3THH)
ARGI1_HUMAN
[Raw transfer]




Z70_B_8(3MFV)
ARGI1_HUMAN
[Raw transfer]




Z70_A_5(3MFV)
ARGI1_HUMAN
[Raw transfer]




ABH_B_11(4GSZ)
ARGI1_HUMAN
[Raw transfer]




B3U_B_8(3MFW)
ARGI1_HUMAN
[Raw transfer]




B3U_A_4(3MFW)
ARGI1_HUMAN
[Raw transfer]




GPA_A_3(4FCK)
ARGI1_HUMAN
[Raw transfer]




1EC_B_6(4IE1)
ARGI1_HUMAN
[Raw transfer]




FB6_A_4(3SL1)
?
[Raw transfer]




6HN_A_5(3F80)
ARGI1_HUMAN
[Raw transfer]




X7A_A_9(4HZE)
ARGI2_HUMAN
[Raw transfer]




6HN_A_5(3F80)
ARGI1_HUMAN
[Raw transfer]




4U7_B_8(3SKK)
ARGI1_HUMAN
[Raw transfer]




X8A_B_6(4HXQ)
ARGI1_HUMAN
[Raw transfer]




X8A_A_3(4HXQ)
ARGI1_HUMAN
[Raw transfer]




ORN_A_5(3GMZ)
ARGI1_HUMAN
[Raw transfer]




HAR_B_8(3LP7)
ARGI1_HUMAN
[Raw transfer]




ORN_B_8(3GMZ)
ARGI1_HUMAN
[Raw transfer]




LYS_A_5(3LP4)
ARGI1_HUMAN
[Raw transfer]




ORN_B_9(3THJ)
ARGI1_HUMAN
[Raw transfer]




ORN_A_5(3THJ)
ARGI1_HUMAN
[Raw transfer]




GPA_A_5(4FCI)
ARGI1_HUMAN
[Raw transfer]




LYS_B_8(3LP4)
ARGI1_HUMAN
[Raw transfer]




GPA_B_6(4FCK)
ARGI1_HUMAN
[Raw transfer]




EXY_A_7(3DJ8)
ARGI1_HUMAN
[Raw transfer]




BCN_B_8(3THE)
ARGI1_HUMAN
[Raw transfer]




DMO_A_5(3GN0)
ARGI1_HUMAN
[Raw transfer]




BCN_A_5(3THE)
ARGI1_HUMAN
[Raw transfer]




EXY_B_8(3DJ8)
ARGI1_HUMAN
[Raw transfer]




DMO_B_8(3GN0)
ARGI1_HUMAN
[Raw transfer]




2AI_A_5(3MJL)
ARGI1_HUMAN
[Raw transfer]




TSZ_A_7(2PHO)
ARGI1_HUMAN
[Raw transfer]




2AI_B_8(3MJL)
ARGI1_HUMAN
[Raw transfer]




44 PsiBlast_CBE 87.0270% -14 - C7 -1CEV - ARGI_BACCD -
1 PsiBlast_PDB 86.8970% -13 - C7 -1CEV - ARGI_BACCD -
39 PsiBlast_CBE 86.6970% -12 - C7 -2CEV - ARGI_BACCD -
24 PsiBlast_CBE 86.6770% -11 - C7 -5CEV - ARGI_BACCD -
37 PsiBlast_CBE 86.6670% -11 - C7 -2CEV - ARGI_BACCD -
34 PsiBlast_CBE 86.5270% -11 - C7 -3CEV - ARGI_BACCD -
3 PsiBlast_PDB 86.5070% -11 - C7 -3CEV - ARGI_BACCD -
36 PsiBlast_CBE 86.4870% -10 - C7 -2CEV - ARGI_BACCD -
33 PsiBlast_CBE 86.4870% -9 - C7 -3CEV - ARGI_BACCD -
41 PsiBlast_CBE 86.4570% -13 - C7 -1CEV - ARGI_BACCD -
42 PsiBlast_CBE 86.4270% -15 - C7 -1CEV - ARGI_BACCD -
31 PsiBlast_CBE 86.3670% -12 - C7 -3CEV - ARGI_BACCD -
45 PsiBlast_CBE 86.3270% -13 - C7 -1CEV - ARGI_BACCD -
40 PsiBlast_CBE 86.3270% -14 - C7 -2CEV - ARGI_BACCD -
43 PsiBlast_CBE 86.2970% -13 - C7 -1CEV - ARGI_BACCD -
32 PsiBlast_CBE 86.2870% -12 - C7 -3CEV - ARGI_BACCD -
21 PsiBlast_CBE 86.1570% -11 - C7 -5CEV - ARGI_BACCD -
29 PsiBlast_CBE 86.1070% -11 - C7 -4CEV - ARGI_BACCD -
106 HHSearch 86.0653%-116 - C7 -2EF5 - ? -
27 PsiBlast_CBE 86.0270% -12 - C7 -4CEV - ARGI_BACCD -
104 HHSearch 72.1042% -2 - C7 -2AEB 3.8 ARGI1_HUMAN
103 HHSearch 71.7634% -37 - C7 -3SL1 3.2 ?
99 PsiBlast_CBE 71.2442% 14 - C7 -4HXQ 3.8 ARGI1_HUMAN
92 PsiBlast_CBE 70.8442% 16 - C7 -2PLL 3.3 ARGI1_HUMAN
87 PsiBlast_CBE 70.7342% 16 - C7 -3GN0 2.5 ARGI1_HUMAN
56 PsiBlast_CBE 70.4742% 12 - C7 -4GSZ 3.0 ARGI1_HUMAN
62 PsiBlast_CBE 70.3942% 17 - C7 -4FCK 4.4 ARGI1_HUMAN
77 PsiBlast_CBE 70.3842% 18 - C7 -3MJL 2.8 ARGI1_HUMAN
97 PsiBlast_CBE 70.3142% 15 - C7 -4IE1 2.9 ARGI1_HUMAN
79 PsiBlast_CBE 70.2842% 16 - C7 -3MFW 2.7 ARGI1_HUMAN
57 PsiBlast_CBE 70.2742% 18 - C7 -4GSV 2.9 ARGI1_HUMAN
13 PsiBlast_PDB 70.2542% 18 - C7 -2PLL 2.8 ARGI1_HUMAN
75 PsiBlast_CBE 70.1742% 17 - C7 -3SJT 3.2 ARGI1_HUMAN
65 PsiBlast_CBE 70.1642% 20 - C7 -3THJ 3.1 ARGI1_HUMAN
83 PsiBlast_CBE 70.1442% 16 - C7 -3LP7 2.9 ARGI1_HUMAN
88 PsiBlast_CBE 70.0142% 19 - C7 -3GMZ 3.1 ARGI1_HUMAN
76 PsiBlast_CBE 69.9742% 16 - C7 -3SJT 3.2 ARGI1_HUMAN
69 PsiBlast_CBE 69.9542% 20 - C7 -3THE 2.2 ARGI1_HUMAN
20 PsiBlast_PDB 69.9442% 20 - C7 -3LP4 2.7 ARGI1_HUMAN
98 PsiBlast_CBE 69.8842% 14 - C7 -4IE1 3.0 ARGI1_HUMAN
95 PsiBlast_CBE 69.8742% 16 - C7 -2AEB 3.6 ARGI1_HUMAN
85 PsiBlast_CBE 69.8642% 18 - C7 -3LP4 2.7 ARGI1_HUMAN
82 PsiBlast_CBE 69.8542% 16 - C7 -3MFV 3.2 ARGI1_HUMAN
86 PsiBlast_CBE 69.7742% 16 - C7 -3KV2 2.8 ARGI1_HUMAN
61 PsiBlast_CBE 69.6942% 16 - C7 -4FCK 3.3 ARGI1_HUMAN
16 PsiBlast_PDB 69.6942% 18 - C7 -3F80 2.9 ARGI1_HUMAN
80 PsiBlast_CBE 69.6542% 17 - C7 -3MFW 2.6 ARGI1_HUMAN
81 PsiBlast_CBE 69.6342% 16 - C7 -3MFV 3.5 ARGI1_HUMAN
17 PsiBlast_PDB 69.5542% 18 - C7 -3KV2 2.7 ARGI1_HUMAN
55 PsiBlast_CBE 69.4442% 21 - C7 -4GSZ 3.0 ARGI1_HUMAN
9 PsiBlast_PDB 69.4242% 21 - C7 -1WVA 3.3 ARGI1_HUMAN
12 PsiBlast_PDB 69.3942% 16 - C7 -2PHO 3.4 ARGI1_HUMAN
100 PsiBlast_CBE 69.3642% 15 - C7 -4HXQ 3.6 ARGI1_HUMAN
18 PsiBlast_PDB 69.3542% 18 - C7 -3GMZ 2.2 ARGI1_HUMAN
96 PsiBlast_CBE 69.3442% 19 - C7 -1WVA 3.1 ARGI1_HUMAN
102 HHSearch 69.2639% 17 - C7 -4HZE 3.6 ARGI2_HUMAN
84 PsiBlast_CBE 69.2642% 20 - C7 -3LP7 2.8 ARGI1_HUMAN
68 PsiBlast_CBE 69.2542% 17 - C7 -3THH 2.8 ARGI1_HUMAN
10 PsiBlast_PDB 69.2442% 19 - C7 -2AEB 3.8 ARGI1_HUMAN
74 PsiBlast_CBE 69.2142% 18 - C7 -3SKK 3.2 ARGI1_HUMAN
89 PsiBlast_CBE 69.2042% 17 - C7 -3F80 3.1 ARGI1_HUMAN
90 PsiBlast_CBE 69.1942% 19 - C7 -3DJ8 3.0 ARGI1_HUMAN
64 PsiBlast_CBE 69.1842% 17 - C7 -4FCI 4.1 ARGI1_HUMAN
70 PsiBlast_CBE 69.1642% 21 - C7 -3THE 2.1 ARGI1_HUMAN
15 PsiBlast_PDB 69.1542% 20 - C7 -3DJ8 2.9 ARGI1_HUMAN
73 PsiBlast_CBE 69.0742% 21 - C7 -3SKK 2.9 ARGI1_HUMAN
51 PsiBlast_CBE 69.0742% 19 - C7 -4GWD 3.3 ARGI1_HUMAN
19 PsiBlast_PDB 69.0242% 19 - C7 -3GN0 2.7 ARGI1_HUMAN
67 PsiBlast_CBE 68.9742% 22 * C7 *3THH 4.0 ARGI1_HUMAN
78 PsiBlast_CBE 68.9142% 16 - C7 -3MJL 3.9 ARGI1_HUMAN
52 PsiBlast_CBE 68.7142% 21 - C7 -4GWD 3.2 ARGI1_HUMAN
66 PsiBlast_CBE 68.6742% 19 - C7 -3THJ 2.8 ARGI1_HUMAN
58 PsiBlast_CBE 68.6142% 19 - C7 -4GSV 3.0 ARGI1_HUMAN
105 HHSearch 67.2032% 14 - C7 -4IU0 3.2 ?