@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu40340: (2016-08-07 )
MTALSKSKEIIDQTSHYGANNYHPLPIVISEALGAWVKDPEGNEYMDMLSAYSAVNQGHRHPKIIQALKDQADKITLTSRAFHNDQLGPFYEKTAKLTGKEMILPMNTGAEAVESAVKAARRWAYEVKGVADNQAEIIACVGNFHGRTMLAVSLSSEEEYKRGFGPMLPGIKLIPYGDVEALRQAITPNTAAFLFEPIQGEAGIVIPPEGFLQEAAAICKEENVLFIADEIQTGLGRTGKTFACDWDGIVPDMYILGKALGGGVFPISCIAADREILGVFNPGSHGSTFGGNPLACAVSIASLEVLEDEKLADRSLELGEYFKSELESIDSPVIKEVRGRGLFIGVELTEAARPYCERLKEEGLLCKETHDTVIRFAPPLIISKEDLDWAIEKIKHVLRNA

Atome Classification :

(56 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PFM_A_5(2OAT)
OAT_HUMAN
[Raw transfer]




PFM_A_5(2OAT)
OAT_HUMAN
[Raw transfer]




PFM_B_6(2OAT)
OAT_HUMAN
[Raw transfer]




PFM_A_5(2OAT)
OAT_HUMAN
[Raw transfer]




P00_A_13(4JEZ)
ARGD_SALTY
[Raw transfer]




P00_A_3(4JEW)
ARGD_SALTY
[Raw transfer]




PFM_C_7(2OAT)
OAT_HUMAN
[Raw transfer]




POI_D_4(1WKG)
ARGD_THET8
[Raw transfer]




P00_B_26(4JEX)
ARGD_SALTY
[Raw transfer]




P00_A_11(4JEX)
ARGD_SALTY
[Raw transfer]




POI_C_3(1WKG)
ARGD_THET8
[Raw transfer]




PLP_A_3(2PB2)
ARGD_SALTY
[Raw transfer]




P00_B_19(4JEW)
ARGD_SALTY
[Raw transfer]




PLP_B_5(4NOG)
?
[Raw transfer]




PLP_A_3(4NOG)
?
[Raw transfer]




PLP_A_3(4NOG)
?
[Raw transfer]




P00_B_18(4JEZ)
ARGD_SALTY
[Raw transfer]




PLP_A_3(2ORD)
ARGD_THEMA
[Raw transfer]




PLP_A_4(2E54)
ARGD_THEMA
[Raw transfer]




PLP_B_10(4ZWM)
?
[Raw transfer]




PLP_A_3(2EO5)
?
[Raw transfer]




PLP_B_6(4PPM)
?
[Raw transfer]




PLP_A_3(4ZWM)
?
[Raw transfer]




PLP_A_3(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_B_9(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_A_3(4JF1)
ARGD_SALTY
[Raw transfer]




PLP_A_5(2BYJ)
OAT_HUMAN
[Raw transfer]




PLP_B_6(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_C_7(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_B_7(4ZLV)
?
[Raw transfer]




PLP_A_3(4ZLV)
?
[Raw transfer]




PLP_A_5(1OAT)
OAT_HUMAN
[Raw transfer]




PLP_B_6(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_B_6(2BYJ)
OAT_HUMAN
[Raw transfer]




PLP_A_5(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_A_4(4PPM)
?
[Raw transfer]




PLP_A_3(2PB0)
ARGD_SALTY
[Raw transfer]




PLP_B_4(1VEF)
ARGD_THET8
[Raw transfer]




PLP_C_7(2BYL)
OAT_HUMAN
[Raw transfer]




PLP_C_7(2BYJ)
OAT_HUMAN
[Raw transfer]




PLP_B_4(2PB0)
ARGD_SALTY
[Raw transfer]




PLP_B_4(2EH6)
ARGD_AQUAE
[Raw transfer]




PLP_A_3(1VEF)
ARGD_THET8
[Raw transfer]




PLP_A_3(1VEF)
ARGD_THET8
[Raw transfer]




PLP_A_3(2EH6)
ARGD_AQUAE
[Raw transfer]




PEG_B_14(5EQC)
?
[Raw transfer]




PEG_A_6(5EQC)
?
[Raw transfer]




EDO_A_7(4JEY)
ARGD_SALTY
[Raw transfer]




EDO_B_7(2PB0)
ARGD_SALTY
[Raw transfer]




106 HHSearch 93.3978%-104 - C1 -3RUY - OAT_BACAN -
1 PsiBlast_PDB 93.0776%-104 - C1 -3RUY - OAT_BACAN -
101 HHSearch 75.1350% -38 - C1 -2OAT 7.2 OAT_HUMAN
3 PsiBlast_PDB 73.6649% -40 - C1 -2OAT 7.2 OAT_HUMAN
21 PsiBlast_CBE 72.9749% -41 - C1 -2OAT 6.4 OAT_HUMAN
23 PsiBlast_CBE 72.6249% -39 - C1 -1OAT 2.9 OAT_HUMAN
22 PsiBlast_CBE 72.4649% -42 - C1 -2OAT 7.7 OAT_HUMAN
24 PsiBlast_CBE 72.3849% -39 - C1 -1OAT 3.1 OAT_HUMAN
28 PsiBlast_CBE 72.1649% -38 - C1 -1GBN - OAT_HUMAN -
2 PsiBlast_PDB 71.9449% -39 - C1 -1OAT 3.1 OAT_HUMAN
4 PsiBlast_PDB 71.9249% -37 - C1 -2CAN - OAT_HUMAN -
7 PsiBlast_PDB 71.8848% -42 - C1 -2BYL 2.7 OAT_HUMAN
27 PsiBlast_CBE 71.7349% -39 - C1 -1GBN - OAT_HUMAN -
31 PsiBlast_CBE 71.5048% -41 - C1 -2BYL 3.2 OAT_HUMAN
25 PsiBlast_CBE 71.4149% -38 - C1 -2CAN - OAT_HUMAN -
29 PsiBlast_CBE 71.2349% -37 - C1 -2BYJ 3.1 OAT_HUMAN
26 PsiBlast_CBE 71.1749% -38 - C1 -2CAN - OAT_HUMAN -
5 PsiBlast_PDB 71.0649% -39 - C1 -1GBN - OAT_HUMAN -
32 PsiBlast_CBE 70.9348% -42 - C1 -2BYL 3.0 OAT_HUMAN
6 PsiBlast_PDB 70.8349% -39 - C1 -2BYJ 3.0 OAT_HUMAN
14 PsiBlast_PDB 70.6449% -38 - C1 -5EQC 2.2 ?
103 HHSearch 70.5648% -33 - C1 -4NOG 4.9 ?
30 PsiBlast_CBE 70.5649% -39 - C1 -2BYJ 3.2 OAT_HUMAN
39 PsiBlast_CBE 69.7749% -38 - C1 -4ZWM 4.1 ?
40 PsiBlast_CBE 69.0249% -36 - C1 -4ZLV 2.8 ?
10 PsiBlast_PDB 68.4449% -36 - C1 -4NOG 4.9 ?
11 PsiBlast_PDB 68.2749% -35 - C1 -4ZLV 2.9 ?
37 PsiBlast_CBE 68.0349% -35 - C1 -5EQC 2.0 ?
36 PsiBlast_CBE 68.0249% -36 - C1 -4NOG 4.7 ?
12 PsiBlast_PDB 67.6649% -38 - C1 -4ZWM 4.4 ?
20 PsiBlast_PDB 64.1836% -72 - C1 -2E54 4.5 ARGD_THEMA
121 Fugue 63.0144% 19 - C1 -2OAT 7.2 OAT_HUMAN
104 HHSearch 62.6435% -64 - C1 -4JF1 4.4 ARGD_SALTY
65 PsiBlast_CBE 60.6934% -66 - C1 -4JEY 2.7 ARGD_SALTY
52 PsiBlast_CBE 60.6134% -67 - C1 -2PB0 3.9 ARGD_SALTY
47 PsiBlast_CBE 59.7734% -66 - C1 -4JEW 5.6 ARGD_SALTY
48 PsiBlast_CBE 59.7434% -69 - C1 -4JEW 6.5 ARGD_SALTY
51 PsiBlast_CBE 59.5534% -65 - C1 -2PB0 3.3 ARGD_SALTY
53 PsiBlast_CBE 59.4434% -63 - C1 -4JF1 4.3 ARGD_SALTY
55 PsiBlast_CBE 59.4034% -68 - C1 -4JEX 5.6 ARGD_SALTY
50 PsiBlast_CBE 59.1034% -69 - C1 -2PB2 3.7 ARGD_SALTY
54 PsiBlast_CBE 57.9234% -68 - C1 -4JF1 4.4 ARGD_SALTY
46 PsiBlast_CBE 57.7735% -68 - C1 -4JEZ 3.6 ARGD_SALTY
56 PsiBlast_CBE 57.7534% -69 - C1 -4JEX 3.9 ARGD_SALTY
45 PsiBlast_CBE 57.6235% -66 - C1 -4JEZ 2.6 ARGD_SALTY
16 PsiBlast_PDB 56.5342% 15 - C1 -1VEF 3.9 ARGD_THET8
43 PsiBlast_CBE 55.4342% 17 - C1 -1VEF 4.0 ARGD_THET8
42 PsiBlast_CBE 54.8942% 17 - C1 -1WKG 6.5 ARGD_THET8
120 HHSearch 53.1936% 4 - C1 -2ORD 4.7 ARGD_THEMA
17 PsiBlast_PDB 53.0942% 16 - C1 -1WKG 6.3 ARGD_THET8
44 PsiBlast_CBE 52.8439% 34 - C1 -2EH6 2.8 ARGD_AQUAE
111 HHSearch 52.4941% 15 - C1 -1VEF 3.9 ARGD_THET8
19 PsiBlast_PDB 49.7539% 37 - C1 -2EH6 2.7 ARGD_AQUAE
81 PsiBlast_CBE 41.4832% 2 - C1 -2EO5 3.4 ?
79 PsiBlast_CBE 30.7532% 22 - C1 -4PPM 4.0 ?
80 PsiBlast_CBE 30.3532% 19 - C1 -4PPM 3.3 ?