@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu40410: (2016-08-07 )
MDKKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEELQPDLILLDIMLPNKDGVEVCREVRKKYDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRRQLTTAPAEEEPSSNEIHIGSLVIFPDAYVVSKRDETIELTHREFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWIVTRRGVGYYLRNPEQD

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_A_3(2GWR)
MTRA_MYCTU
[Raw transfer]




NACID_D_4(4NHJ)
?
[Raw transfer]

-

19 PsiBlast_PDB 85.7745%-137 - C5 -2GWR - MTRA_MYCTU -
103 HHSearch 85.4346%-138 - C5 -2GWR 3.1 MTRA_MYCTU
106 HHSearch 78.8045% -69 - C5 -1YS7 - PRRA_MYCTU -
21 PsiBlast_CBE 74.24100%-131 - C4 -2ZWM - YYCF_BACSU -
2 PsiBlast_PDB 74.24100%-129 - C4 -3F6P - YYCF_BACSU -
1 PsiBlast_PDB 73.72100%-127 - C4 -2ZWM - YYCF_BACSU -
104 HHSearch 73.0433%-140 - C5 -4KFC - KDPE_ECOLI -
108 HHSearch 73.0048%-100 - C5 -2OQR - REGX3_MYCTU -
4 PsiBlast_PDB 72.9247% -99 - C5 -2OQR - REGX3_MYCTU -
16 PsiBlast_PDB 71.3244% -60 - C5 -1YS6 - PRRA_MYCTU -
23 PsiBlast_CBE 70.6044% -56 - C5 -1YS6 - PRRA_MYCTU -
22 PsiBlast_CBE 70.2944% -56 - C5 -1YS7 - PRRA_MYCTU -
17 PsiBlast_PDB 70.1544% -63 - C5 -1YS7 - PRRA_MYCTU -
110 HHSearch 69.2738% -75 - C5 -1P2F - ? -
39 PsiBlast_CBE 68.7634% -64 - C4 -4S04 - ? -
9 PsiBlast_PDB 67.7067%-138 - C4 -1NXS - ? -
24 PsiBlast_CBE 67.6135% -91 - C4 -4KNY - KDPE_ECOLI -
12 PsiBlast_PDB 67.5367%-143 - C4 -1NXX - ? -
7 PsiBlast_PDB 66.8767%-142 - C4 -1NXO - ? -
37 PsiBlast_CBE 66.5834% -75 - C4 -4S05 - ? -
119 HHSearch 41.9639%-146 - C5 -4NHJ 4.6 ?