@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu40620: (2016-08-07 )
MIEVLNLTKKIKKTTVLDNISYTFEKGTIYGLFGSNGSGKTMLLRALSGLIVPTEGSITIKGEQLHKDISFPKSVGLIIENMQLLPQYDAFTNLKILSKIKKIASDNDILDSISRVGLENFNSVKVSKFSLGMKQRLNIAQAIFEKPDILLLDEPTNAIDEKGVAFVHDILLQEKKRGATIIITSHHKEDIISLCDIALEMNHGRLETSEKVIYKKDS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_3(3FVQ)
FBPC_NEIG1
[Raw transfer]




42 HHSearch 77.0429% -5 * C1 *3TUI - METN_ECOLI -
7 PsiBlast_PDB 76.5328% -41 - C1 -4YMS - ? -
9 PsiBlast_PDB 75.9728% -42 - C1 -4YMU - ? -
11 PsiBlast_PDB 74.9028% -41 - C1 -4YMW - ? -
32 HHSearch 74.5130% -31 - C1 -4YER - ? -
4 PsiBlast_PDB 73.0129% 0 - C1 -3TUZ - METN_ECOLI -
3 PsiBlast_PDB 72.8229% -4 - C1 -3TUI - METN_ECOLI -
10 PsiBlast_PDB 70.2328% -42 - C1 -4YMV - ? -
8 PsiBlast_PDB 69.7428% -44 - C1 -4YMT - ? -
22 Fugue 68.7029% 8 - C1 -3TUZ - METN_ECOLI -
5 PsiBlast_PDB 68.4228% 1 - C1 -3TUJ - METN_ECOLI -
34 HHSearch 66.9625% -34 - C1 -2IT1 - ? -
37 HHSearch 66.1628% -93 - C1 -3D31 - ? -
36 HHSearch 62.7424% -33 - C1 -2YYZ - ? -
20 PsiBlast_PDB 62.6927% -58 - C1 -4XIG - ? -
19 PsiBlast_PDB 62.6127% -56 - C1 -4TQV - ? -
17 PsiBlast_PDB 62.5227% -24 - C1 -2YYZ - ? -
18 PsiBlast_PDB 62.1527% -59 - C1 -4TQU - ? -
2 PsiBlast_PDB 62.1229% 1 - C1 -3DHW - METN_ECOLI -
31 HHSearch 61.7326% -54 - C1 -4TQU - ? -