@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu40850: (2016-08-08 )
MLRTEKEKMAAGELYNSEDQQLLLERKHARQLIRQYNETPEDDAVRTKLLKELLGSVGDQVTILPTFRCDYGYHIHIGDHTFVNFDCVILDVCEVRIGCHCLIAPGVHIYTAGHPLDPIERKSGKEFGKPVTIGDQVWIGGRAVINPGVTIGDNAVIASGSVVTKDVPANTVVGGNPARILKQL

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

COA_B_9(3V4E)
ATRF2_STAAC
[Raw transfer]




COA_A_6(3V4E)
ATRF2_STAAC
[Raw transfer]




COA_B_8(3V4E)
ATRF2_STAAC
[Raw transfer]




GOL_E_12(4EGG)
ATRF2_STAAC
[Raw transfer]




GOL_A_7(3IGJ)
?
[Raw transfer]




GOL_A_6(3SRT)
?
[Raw transfer]




GOL_A_6(3SRT)
?
[Raw transfer]




GOL_E_13(4EGG)
ATRF2_STAAC
[Raw transfer]




COA_E_5(1KQA)
THGA_ECOLI
[Raw transfer]




GOL_A_12(3HJJ)
?
[Raw transfer]




COA_G_7(1KRV)
THGA_ECOLI
[Raw transfer]




COA_E_5(1KRU)
THGA_ECOLI
[Raw transfer]




COA_F_6(1KRU)
THGA_ECOLI
[Raw transfer]




1 PsiBlast_PDB 79.1970% -41 - C1 -2IC7 - ? -
2 PsiBlast_PDB 79.0270% -46 - C1 -2P2O - ? -
108 HHSearch 78.8670% -46 - C1 -2P2O - ? -
21 PsiBlast_CBE 78.6365% -57 - C1 -1OCX - MAA_ECOLI -
3 PsiBlast_PDB 78.2265% -62 - C1 -1OCX - MAA_ECOLI -
22 PsiBlast_CBE 77.9265% -62 - C1 -1OCX - MAA_ECOLI -
110 HHSearch 77.1066% -60 - C1 -1OCX - MAA_ECOLI -
5 PsiBlast_PDB 76.3763% -36 - C1 -3IGJ 3.0 ?
4 PsiBlast_PDB 76.0963% -37 - C1 -3HJJ - ? -
114 HHSearch 75.7563% -38 - C1 -3HJJ 2.6 ?
113 HHSearch 75.2745%-140 - C1 -3NZ2 - ? -
8 PsiBlast_PDB 75.0044%-141 - C1 -3NZ2 - ? -
7 PsiBlast_PDB 72.8552% -44 - C1 -4ISX - ? -
6 PsiBlast_PDB 71.7352% -45 - C1 -3SRT 3.3 ?
109 HHSearch 70.9752% -46 - C1 -3SRT 3.3 ?
29 PsiBlast_CBE 67.5340% -65 - C1 -1KQA 3.8 THGA_ECOLI
27 PsiBlast_CBE 67.4140% -65 - C1 -1KRR - THGA_ECOLI -
25 PsiBlast_CBE 66.8640% -56 - C1 -1KRU 3.3 THGA_ECOLI
23 PsiBlast_CBE 66.6940% -55 - C1 -1KRV - THGA_ECOLI -
28 PsiBlast_CBE 65.7640% -53 - C1 -1KRR - THGA_ECOLI -
24 PsiBlast_CBE 65.7040% -54 - C1 -1KRV 3.1 THGA_ECOLI
11 PsiBlast_PDB 65.3640% -56 - C1 -1KRU 3.3 THGA_ECOLI
13 PsiBlast_PDB 65.0538% -16 - C1 -3V4E 4.4 ATRF2_STAAC
33 PsiBlast_CBE 64.9438% -17 - C1 -4EGG 3.0 ATRF2_STAAC
31 PsiBlast_CBE 64.4038% -16 - C1 -3V4E 4.1 ATRF2_STAAC
32 PsiBlast_CBE 63.3638% -17 - C1 -3V4E 3.3 ATRF2_STAAC
34 PsiBlast_CBE 61.7638% -18 - C1 -4EGG 3.9 ATRF2_STAAC