@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu41050: (2016-08-08 )
MKKRNRLKKNEDFQKVFKHGTSVANRQFVLYTLDQPENDELRVGLSVSKKIGNAVMRNRIKRLIRQAFLEEKERLKEKDYIIIARKPASQLTYEETKKSLQHLFRKSSLYKKSSSK

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PPV_A_4(4JG4)
RNPA_BACSU
[Raw transfer]




PPV_A_4(4JG4)
RNPA_BACSU
[Raw transfer]




1 PsiBlast_PDB 87.6699% -79 - C4 -1A6F - RNPA_BACSU -
15 HHSearch 86.7097% -82 - C4 -4JG4 3.1 RNPA_BACSU
2 PsiBlast_PDB 84.8296% -94 - C4 -4JG4 3.1 RNPA_BACSU
13 HHSearch 73.0749% -75 - C4 -1D6T - RNPA_STAAU -
3 PsiBlast_PDB 72.6049% -80 - C4 -1D6T - RNPA_STAAU -
14 HHSearch 67.3031% -87 - C4 -1NZ0 - RNPA_THEMA -
6 PsiBlast_PDB 61.5635%-108 - C4 -3Q1Q - RNPA_THEMA -
7 PsiBlast_PDB 61.4435%-108 - C4 -3Q1R - RNPA_THEMA -
5 PsiBlast_PDB 61.1435%-116 - C4 -1NZ0 - RNPA_THEMA -
16 HHSearch 56.6727% -1 - C4 -2LJP - RNPA_ECOLI -
4 PsiBlast_PDB 53.3129% 45 - C4 -2LJP - RNPA_ECOLI -
17 HHSearch 44.6623%-125 - C4 -4OXP - ? -
28 Fugue 38.0823% -5 - C5 -4WBE - CAPR1_HUMAN -
21 HHSearch 33.197%-228 - C4 -3R3T - RS6_BACAN -
20 HHSearch 32.2313%-146 * C4 *1CQM - RS6_THETH -
31 Fugue 31.9014% 44 - C5 -5IQJ - ? -
30 Fugue 30.5521% 56 * C5 *2EHP - Y1627_AQUAE -
10 PsiBlast_PDB 27.5332% -5 * C6 *1N8S - LIPP_HUMAN -
9 PsiBlast_PDB 25.2532% 51 - C6 -1LPB - LIPP_HUMAN -
23 HHSearch 25.043% -66 - C4 -2J5A - RS6_AQUAE -