@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0052: (2016-04-19 )
MPSFDVVFVGHRRGEVRSDNAMLGLLCDAAFDELTRPDVVIFPGGIGTRTLIHDQTVLDWVREAHRHTLLTTSVCTGGLVLAAAGLLNGLTATTHWRVQDLFNSLGARYVPQRVVEHLPERVITAAGVSSGIDMGLRLVELLVSREAAEASQLMIEYDPQPPVDAGSLAKASPATHRLALEFYQHRL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NHE_B_7(3NOQ)
?
[Raw transfer]




GOL_A_2(3EWN)
?
[Raw transfer]




EDO_B_6(3NON)
?
[Raw transfer]




EDO_B_9(3NOO)
?
[Raw transfer]




23 PsiBlast_CBE 94.5237%-124 - C1 -3NON 2.2 ?
5 PsiBlast_PDB 93.9837%-126 - C1 -3NON - ? -
22 PsiBlast_CBE 91.7337%-121 - C1 -3NOQ 2.4 ?
4 PsiBlast_PDB 91.1937%-121 - C1 -3NOQ - ? -
24 HHSearch 90.6936%-112 - C1 -3NOQ - ? -
1 PsiBlast_PDB 90.3837%-111 - C1 -3NOV - ? -
2 PsiBlast_PDB 88.8037%-116 - C1 -3NOR - ? -
21 PsiBlast_CBE 88.4737%-110 - C1 -3NOO 2.7 ?
25 HHSearch 88.2437%-112 - C1 -3EWN 3.0 ?
3 PsiBlast_PDB 87.8937%-111 - C1 -3NOO - ? -
6 PsiBlast_PDB 73.9340% -98 - C1 -3EWN - ? -
31 HHSearch 63.9423%-110 - C1 -2RK3 - PARK7_HUMAN -
47 Fugue 61.7030% -91 - C1 -3EWN - ? -
30 HHSearch 61.1722%-113 * C1 *4E08 - ? -
39 HHSearch 59.6120%-124 - C1 -3L18 - ? -
37 HHSearch 59.3023%-106 - C1 -2AB0 - YAJL_ECOLI -
35 HHSearch 58.5221%-120 - C1 -4HCJ - ? -
32 HHSearch 56.2923%-109 - C1 -4K2H - ? -
27 HHSearch 54.4529%-104 - C1 -3MGK - ? -
8 PsiBlast_PDB 53.8929%-115 - C1 -2AB0 - YAJL_ECOLI -