@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0073: (2016-04-19 )
MGDLSIQNLVVEYYSGGYALRPINGLNLDVAAGSLVMLLGPSGCGKTTLLSCLGGILRPKSGAIKFDEVDITTLQGAELANYRRNKVGIVFQAFNLVPSLTAVENVMVPLRSAGMSRRASRRRAEELLARVNLAERMNHRPGDLSGGQQQRVAVARAIALDPPLILADEPTAHLDFIQVEEVLRLIRELADGERVVVVATHDSRMLPMADRVVELTPDFAETNRPPETVHLQAGEVLFEQSTMGDLIYVVSEGEFEIVHELADGGEELVKVAGPGDYFGEIGVLFHLPRSATVRARSDATAVGYTVQAFRERLGVGGLRDLIEHRALAND

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_C_3(1VCI)
?
[Raw transfer]




ATP_B_5(4QC2)
?
[Raw transfer]




ANP_A_2(4AYW)
ABCBA_HUMAN
[Raw transfer]




22 PsiBlast_CBE 88.4841%-127 - C1 -3TIF - Y796_METJA -
2 PsiBlast_PDB 86.7141%-121 - C1 -3TIF - Y796_METJA -
21 PsiBlast_CBE 85.7141%-127 - C1 -1L2T - Y796_METJA -
3 PsiBlast_PDB 85.3641%-121 - C1 -1F3O - Y796_METJA -
1 PsiBlast_PDB 84.4241%-122 - C1 -1L2T - Y796_METJA -
59 PsiBlast_CBE 81.1635% -89 - C1 -1Z47 - ? -
118 Fugue 80.9329%-104 - C1 -3B60 - MSBA_SALTY -
58 PsiBlast_CBE 80.8335% -90 - C1 -1Z47 - ? -
8 PsiBlast_PDB 78.2739%-113 - C1 -4YMW - ? -
12 PsiBlast_PDB 78.2640%-115 - C1 -4U00 - ? -
24 PsiBlast_CBE 77.3139%-115 - C1 -4YMU - ? -
28 PsiBlast_CBE 77.2840%-116 - C1 -4U02 - ? -
7 PsiBlast_PDB 77.2839%-111 - C1 -4YMV - ? -
27 PsiBlast_CBE 77.2740%-114 - C1 -4U02 - ? -
29 PsiBlast_CBE 77.1740%-113 - C1 -4U02 - ? -
4 PsiBlast_PDB 77.0439%-116 - C1 -4YMS - ? -
23 PsiBlast_CBE 76.5739%-111 - C1 -4YMV - ? -
13 PsiBlast_PDB 76.4440%-110 - C1 -4U02 - ? -
6 PsiBlast_PDB 76.3539%-110 - C1 -4YMU - ? -
5 PsiBlast_PDB 76.0239%-114 - C1 -4YMT - ? -
61 PsiBlast_CBE 70.8639%-114 - C1 -1B0U 4.4 HISP_SALTY
109 PsiBlast_CBE 57.6532%-107 - C1 -4QC2 7.5 ?
60 PsiBlast_CBE 57.6534%-106 - C1 -1VCI 4.8 ?
108 PsiBlast_CBE 43.8433% -78 - C1 -4AYW 5.5 ABCBA_HUMAN