@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0241c: (2016-04-20 )
MTQPSGLKNLLRAAAGALPVVPRTDQLPNRTVTVEELPIDPANVAAYAAVTGLRYGNQVPLTYPFALTFPSVMSLVTGFDFPFAAMGAIHTENHITQYRPIAVTDAVGVRVRAENLREHRRGLLVDLVTNVSVGNDVAWHQVTTFLHQQRTSLSGEPKPPPQKKPKLPPPAAVLRITPAKIRRYAAVGGDHNPIHTNPIAAKLFGFPTVIAHGMFTAAAVLANIEARFPDAVRYSVRFAKPVLLPATAGLYVAEGDGGWDLTLRNMAKGYPHLTATVRGL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

P6G_A_8(4RLJ)
?
[Raw transfer]




GOL_A_5(5CPG)
?
[Raw transfer]




GOL_B_8(5CPG)
?
[Raw transfer]




79 Fugue 97.08100%-147 - C5 -3WEW - ? -
1 PsiBlast_PDB 97.08100%-147 - C5 -3WEW - ? -
58 HHSearch 96.73100%-127 - C5 -4OOB - ? -
2 PsiBlast_PDB 96.42100%-127 - C5 -4OOB - ? -
66 HHSearch 59.6023%-107 - C5 -2UV8 - ? -
62 HHSearch 55.7617% -70 - C5 -3KH8 - ? -
63 HHSearch 55.7019% -79 - C5 -3KHP - ? -
83 Fugue 54.9424% -73 - C5 -4V12 - ? -
64 HHSearch 54.9321% -88 - C5 -4V12 - ? -
61 HHSearch 53.1218% -78 - C5 -3OML - DHB4_DROME -
59 HHSearch 50.5618% -87 - C5 -1PN2 - FOX2_CANTR -
70 HHSearch 46.2334%-110 - C5 -4RLJ Error ?
80 Fugue 45.8317% -71 - C5 -1PN2 - FOX2_CANTR -
68 HHSearch 44.1325%-105 * C5 *1IQ6 - PHAJ_AERCA -
71 HHSearch 43.9525%-105 - C5 -5CPG 3.0 ?
65 HHSearch 43.8214% -75 - C5 -4E3E - MCH_CHLAA -
12 PsiBlast_PDB 43.3136%-109 - C5 -4RV2 - ? -
78 HHSearch 42.9817% -95 - C5 -4RLJ - Y635_MYCTU -
13 PsiBlast_PDB 41.4921% -65 - C5 -3KH8 - ? -
7 PsiBlast_PDB 40.6936% -99 - C5 -4RLJ - ? -