@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0334: (2016-04-21 )
MRGIILAGGSGTRLYPITMGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTPHDAPGFHRLLGDGAHLGVNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDNIFYGPGLGTSLKRFQSISGGAIFAYWVANPSAYGVVEFGAEGMALSLEEKPVTPKSNYAVPGLYFYDNDVIEIARGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTAWLDTGTFDSLLDAADFVRTLERRQGLKVSIPEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERN

Atome Classification :

(84 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

Y46_A_5(3ZLK)
?
[Raw transfer]




Y46_D_11(3ZLK)
?
[Raw transfer]




Y46_C_9(3ZLK)
?
[Raw transfer]




Y46_B_7(3ZLK)
?
[Raw transfer]




942_C_11(4B42)
?
[Raw transfer]




BBE_A_5(4B5B)
?
[Raw transfer]




HNR_C_12(4ARW)
?
[Raw transfer]




HNR_B_8(4ARW)
?
[Raw transfer]




JWT_D_14(4B4M)
?
[Raw transfer]




KKT_C_10(4B4G)
?
[Raw transfer]




JWT_A_5(4B4M)
?
[Raw transfer]




BBE_C_9(4B5B)
?
[Raw transfer]




BBE_D_11(4B5B)
?
[Raw transfer]




JWT_C_11(4B4M)
?
[Raw transfer]




HNR_D_16(4ARW)
?
[Raw transfer]




942_D_14(4B42)
?
[Raw transfer]




HNR_A_5(4ARW)
?
[Raw transfer]




BBE_B_7(4B5B)
?
[Raw transfer]




942_B_8(4B42)
?
[Raw transfer]




KKT_B_7(4B4G)
?
[Raw transfer]




942_A_5(4B42)
?
[Raw transfer]




UTP_B_11(4HO9)
?
[Raw transfer]




KKT_A_5(4B4G)
?
[Raw transfer]




UTP_A_3(4HO6)
?
[Raw transfer]




THM_D_20(1H5R)
RMLA1_ECOLI
[Raw transfer]




THM_B_9(4HO4)
?
[Raw transfer]




UTP_A_4(4HO9)
?
[Raw transfer]




GOL_B_12(3ZLL)
?
[Raw transfer]




DAU_B_9(4HO5)
?
[Raw transfer]




GOL_D_19(4B3U)
?
[Raw transfer]




TTP_A_3(4HO3)
?
[Raw transfer]




TYD_B_8(1H5T)
RMLA1_ECOLI
[Raw transfer]




DAU_A_4(4HO5)
?
[Raw transfer]




TYD_D_12(1H5T)
RMLA1_ECOLI
[Raw transfer]




BZ0_A_5(4B2W)
?
[Raw transfer]




THM_C_18(1H5R)
RMLA1_ECOLI
[Raw transfer]




JWT_B_8(4B4M)
?
[Raw transfer]




THM_A_5(4HO4)
?
[Raw transfer]




THM_A_6(4HO8)
?
[Raw transfer]




KKT_D_13(4B4G)
?
[Raw transfer]




THM_A_5(4HO4)
?
[Raw transfer]




BZ0_C_11(4B2W)
?
[Raw transfer]




THM_B_11(4HO8)
?
[Raw transfer]




THM_A_3(4HO2)
?
[Raw transfer]




BZ0_B_8(4B2W)
?
[Raw transfer]




THM_D_23(4HO8)
?
[Raw transfer]




TTP_G_7(1IIM)
RMLA_SALTY
[Raw transfer]




TMP_A_5(1H5S)
RMLA1_ECOLI
[Raw transfer]




THM_B_16(1H5R)
RMLA1_ECOLI
[Raw transfer]




THM_A_14(1H5R)
RMLA1_ECOLI
[Raw transfer]




TMP_C_9(1H5S)
RMLA1_ECOLI
[Raw transfer]




TTP_G_7(1MP3)
RMLA_SALTY
[Raw transfer]




BZ0_D_14(4B2W)
?
[Raw transfer]




TTP_K_11(1MP3)
RMLA_SALTY
[Raw transfer]




TMP_B_7(1H5S)
RMLA1_ECOLI
[Raw transfer]




TYD_A_6(1H5T)
RMLA1_ECOLI
[Raw transfer]




THM_C_17(4HO8)
?
[Raw transfer]




NIQ_B_7(4B2X)
?
[Raw transfer]




NIQ_D_11(4B2X)
?
[Raw transfer]




TYD_C_10(1H5T)
RMLA1_ECOLI
[Raw transfer]




TTP_K_11(1IIM)
RMLA_SALTY
[Raw transfer]




TTP_K_11(1IIM)
RMLA_SALTY
[Raw transfer]




GJB_D_14(4B4B)
?
[Raw transfer]




NIQ_A_5(4B2X)
?
[Raw transfer]




GJB_A_5(4B4B)
?
[Raw transfer]




NIQ_C_9(4B2X)
?
[Raw transfer]




GJB_C_11(4B4B)
?
[Raw transfer]




GJB_B_8(4B4B)
?
[Raw transfer]




NWL_B_9(4B3U)
?
[Raw transfer]




NWL_C_12(4B3U)
?
[Raw transfer]




NWL_D_17(4B3U)
?
[Raw transfer]




4WF_B_10(3ZLL)
?
[Raw transfer]




4WF_A_5(3ZLL)
?
[Raw transfer]




4WF_D_17(3ZLL)
?
[Raw transfer]




NWL_A_5(4B3U)
?
[Raw transfer]




4WF_C_14(3ZLL)
?
[Raw transfer]




30 PsiBlast_CBE 97.3961%-132 - C1 -5IDT - ? -
29 PsiBlast_CBE 96.8161%-129 - C1 -5IDT - ? -
5 PsiBlast_PDB 95.7061%-128 - C1 -5IDT - ? -
56 PsiBlast_CBE 95.4659%-126 - C1 -4HO5 4.9 ?
57 PsiBlast_CBE 95.4259%-127 - C1 -4HO4 3.7 ?
4 PsiBlast_PDB 94.5861%-129 - C1 -5IDS - ? -
13 PsiBlast_PDB 94.0459%-127 - C1 -4HO0 - ? -
50 PsiBlast_CBE 93.6859%-126 - C1 -4HOC - ? -
36 PsiBlast_CBE 93.4960%-131 - C1 -3PKP - RMLA_SALTY -
38 PsiBlast_CBE 93.4660%-127 - C1 -3PKP - RMLA_SALTY -
16 PsiBlast_PDB 93.3159%-123 - C1 -4HO4 3.9 ?
8 PsiBlast_PDB 93.1760%-129 - C1 -3PKP - RMLA_SALTY -
54 PsiBlast_CBE 93.1459%-123 - C1 -4HO8 3.7 ?
20 PsiBlast_PDB 93.1459%-124 - C1 -4HO9 4.4 ?
73 PsiBlast_CBE 93.1262%-122 - C1 -4B4B 3.9 ?
41 PsiBlast_CBE 93.0860%-133 - C1 -3PKP - RMLA_SALTY -
18 PsiBlast_PDB 93.0759%-121 - C1 -4HO6 4.5 ?
85 PsiBlast_CBE 93.0662%-123 - C1 -4B2X 4.3 ?
105 HHSearch 92.9660%-122 - C1 -4HO4 3.9 ?
98 PsiBlast_CBE 92.9262%-120 - C1 -4ARW 3.6 ?
15 PsiBlast_PDB 92.8059%-125 - C1 -4HO3 5.1 ?
88 PsiBlast_CBE 92.7762%-127 - C1 -4B2W 3.7 ?
70 PsiBlast_CBE 92.7662%-121 - C1 -4B4B 3.4 ?
99 PsiBlast_CBE 92.6662%-127 - C1 -4ARW 4.1 ?
81 PsiBlast_CBE 92.6662%-123 - C1 -4B3U 4.3 ?
60 PsiBlast_CBE 92.6562%-121 - C1 -4B5B 3.8 ?
93 PsiBlast_CBE 92.6362%-123 - C1 -3ZLL 3.4 ?
53 PsiBlast_CBE 92.5659%-122 - C1 -4HO8 3.9 ?
97 PsiBlast_CBE 92.4862%-123 - C1 -3ZLK 4.8 ?
69 PsiBlast_CBE 92.4162%-125 - C1 -4B4G 4.5 ?
52 PsiBlast_CBE 92.3259%-123 - C1 -4HO9 4.8 ?
90 PsiBlast_CBE 92.1962%-120 - C1 -3ZLL 3.0 ?
83 PsiBlast_CBE 92.1862%-123 - C1 -4B2X 4.0 ?
14 PsiBlast_PDB 92.0059%-124 - C1 -4HO2 4.1 ?
61 PsiBlast_CBE 91.9962%-120 - C1 -4B5B 4.8 ?
64 PsiBlast_CBE 91.8762%-118 - C1 -4B4M 4.6 ?
80 PsiBlast_CBE 91.8362%-120 - C1 -4B3U 4.4 ?
96 PsiBlast_CBE 91.6662%-121 - C1 -3ZLK 4.5 ?
65 PsiBlast_CBE 91.6562%-122 - C1 -4B4M 5.0 ?
17 PsiBlast_PDB 91.6359%-121 - C1 -4HO5 4.9 ?
31 PsiBlast_CBE 91.5961%-124 - C1 -1H5S 4.0 RMLA1_ECOLI
94 PsiBlast_CBE 91.4962%-122 - C1 -3ZLK 4.9 ?
92 PsiBlast_CBE 91.4562%-123 - C1 -3ZLL 3.4 ?
89 PsiBlast_CBE 91.3362%-121 - C1 -4B2W 4.2 ?
72 PsiBlast_CBE 91.1862%-124 - C1 -4B4B 3.5 ?
68 PsiBlast_CBE 91.1362%-128 - C1 -4B4G 4.7 ?
101 PsiBlast_CBE 91.0862%-122 - C1 -4ARW 3.8 ?
95 PsiBlast_CBE 91.0562%-124 - C1 -3ZLK 5.0 ?
91 PsiBlast_CBE 91.0562%-123 - C1 -3ZLL 3.3 ?
19 PsiBlast_PDB 90.9859%-123 - C1 -4HO8 4.0 ?
79 PsiBlast_CBE 90.9562%-123 - C1 -4B3U 4.0 ?
71 PsiBlast_CBE 90.9162%-121 - C1 -4B4B 3.5 ?
55 PsiBlast_CBE 90.7459%-123 - C1 -4HO8 3.9 ?
84 PsiBlast_CBE 90.7062%-122 - C1 -4B2X 3.5 ?
62 PsiBlast_CBE 90.6262%-121 - C1 -4B4M 4.6 ?
75 PsiBlast_CBE 90.6062%-121 - C1 -4B42 3.5 ?
28 PsiBlast_CBE 90.2562%-124 - C1 -1H5R 4.0 RMLA1_ECOLI
21 PsiBlast_CBE 90.2461%-122 - C1 -1H5T 4.1 RMLA1_ECOLI
100 PsiBlast_CBE 90.2362%-122 - C1 -4ARW 3.7 ?
3 PsiBlast_PDB 90.1661%-119 - C1 -1H5R 3.9 RMLA1_ECOLI
67 PsiBlast_CBE 90.1462%-120 - C1 -4B4G 5.2 ?
63 PsiBlast_CBE 90.0962%-123 - C1 -4B4M 5.4 ?
78 PsiBlast_CBE 90.0462%-119 - C1 -4B3U 4.4 ?
86 PsiBlast_CBE 90.0362%-122 - C1 -4B2W 4.4 ?
77 PsiBlast_CBE 90.0362%-119 - C1 -4B42 3.9 ?
66 PsiBlast_CBE 89.9362%-122 - C1 -4B4G 4.3 ?
58 PsiBlast_CBE 89.9262%-118 - C1 -4B5B 4.7 ?
11 PsiBlast_PDB 89.8959%-121 - C1 -1MP3 3.9 RMLA_SALTY
82 PsiBlast_CBE 89.8562%-119 - C1 -4B2X 3.7 ?
24 PsiBlast_CBE 89.7961%-121 - C1 -1H5R 3.6 RMLA1_ECOLI
26 PsiBlast_CBE 89.7562%-122 - C1 -1H5T 4.1 RMLA1_ECOLI
2 PsiBlast_PDB 89.7061%-122 - C1 -1H5T 4.0 RMLA1_ECOLI
59 PsiBlast_CBE 89.6862%-122 - C1 -4B5B 4.2 ?
25 PsiBlast_CBE 89.6261%-118 - C1 -1H5R 3.6 RMLA1_ECOLI
87 PsiBlast_CBE 89.2562%-124 - C1 -4B2W 3.9 ?
76 PsiBlast_CBE 89.2362%-121 - C1 -4B42 4.3 ?
23 PsiBlast_CBE 89.0061%-120 - C1 -1H5S 3.8 RMLA1_ECOLI
48 PsiBlast_CBE 88.9359%-122 - C1 -1MP3 4.3 RMLA_SALTY
104 HHSearch 88.4760%-119 * C1 *1IIM 4.0 RMLA_SALTY
6 PsiBlast_PDB 88.4460%-119 - C1 -1IIM 4.0 RMLA_SALTY
74 PsiBlast_CBE 88.3162%-119 - C1 -4B42 3.9 ?
35 PsiBlast_CBE 88.1260%-120 - C1 -1IIM 4.2 RMLA_SALTY
22 PsiBlast_CBE 87.8761%-119 - C1 -1H5T 4.0 RMLA1_ECOLI
27 PsiBlast_CBE 87.8362%-122 - C1 -1H5S 4.2 RMLA1_ECOLI