@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0642c: (2016-04-24 )
MTRMAEKPISPTKTRTRFEDIQAHYDVSDDFFALFQDPTRTYSCAYFEPPELTLEEAQYAKVDLNLDKLDLKPGMTLLDIGCGWGTTMRRAVERFDVNVIGLTLSKNQHARCEQVLASIDTNRSRQVLLQGWEDFAEPVDRIVSIEAFEHFGHENYDDFFKRCFNIMPADGRMTVQSSVSYHPYEMAARGKKLSFETARFIKFIVTEIFPGGRLPSTEMMVEHGEKAGFTVPEPLSLRPHYIKTLRIWGDTLQSNKDKAIEVTSEEVYNRYMKYLRGCEHYFTDEMLDCSLVTYLKPGAAA

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SAM_B_2(2FK8)
MMAA4_MYCTU
[Raw transfer]




SAM_B_2(2FK8)
MMAA4_MYCTU
[Raw transfer]




SAH_L_12(1KPH)
CMAS1_MYCTU
[Raw transfer]




SAH_A_9(1KPG)
CMAS1_MYCTU
[Raw transfer]




SAH_J_10(1KPH)
CMAS1_MYCTU
[Raw transfer]




SAH_C_3(1TPY)
MMAA2_MYCTU
[Raw transfer]




SAH_A_2(3HA3)
MMAA4_MYCTU
[Raw transfer]




SAH_K_11(1KPH)
CMAS1_MYCTU
[Raw transfer]




SAH_E_5(1L1E)
CMAS3_MYCTU
[Raw transfer]




SAH_A_9(1KPG)
CMAS1_MYCTU
[Raw transfer]




SAH_F_6(1L1E)
CMAS3_MYCTU
[Raw transfer]




SAH_I_9(1KPH)
CMAS1_MYCTU
[Raw transfer]




SAH_I_9(1KPH)
CMAS1_MYCTU
[Raw transfer]




SAH_I_9(1KPH)
CMAS1_MYCTU
[Raw transfer]




SAH_G_7(1KPI)
CMAS2_MYCTU
[Raw transfer]




B32_A_2(3HA7)
MMAA4_MYCTU
[Raw transfer]




10A_P_16(1KPH)
CMAS1_MYCTU
[Raw transfer]




10A_O_15(1KPH)
CMAS1_MYCTU
[Raw transfer]




16A_D_4(1TPY)
MMAA2_MYCTU
[Raw transfer]




D22_A_2(3HEM)
CMAS2_MYCTU
[Raw transfer]




16A_A_13(1KPG)
CMAS1_MYCTU
[Raw transfer]




D22_A_2(3HEM)
CMAS2_MYCTU
[Raw transfer]




SFG_A_2(3HA5)
MMAA4_MYCTU
[Raw transfer]




ACY_C_3(1KP9)
CMAS1_MYCTU
[Raw transfer]




ACY_D_4(1KP9)
CMAS1_MYCTU
[Raw transfer]




72 HHSearch 96.12100%-108 - C1 -2FK8 9.3 MMAA4_MYCTU
3 PsiBlast_PDB 96.0099%-107 - C1 -3HA3 6.8 MMAA4_MYCTU
2 PsiBlast_PDB 95.8599%-108 - C1 -2FK8 9.3 MMAA4_MYCTU
4 PsiBlast_PDB 95.7399%-108 - C1 -3HA5 7.7 MMAA4_MYCTU
1 PsiBlast_PDB 94.0099%-108 - C1 -2FK7 - MMAA4_MYCTU -
5 PsiBlast_PDB 88.4999%-106 - C1 -3HA7 9.4 MMAA4_MYCTU
63 Fugue 77.4759% -97 - C1 -1KPH 8.1 CMAS1_MYCTU
62 Fugue 77.4759% -97 - C1 -1KPH 8.1 CMAS1_MYCTU
8 PsiBlast_PDB 77.0656% -99 - C1 -1KPG 8.2 CMAS1_MYCTU
10 PsiBlast_PDB 76.6955%-101 - C1 -1L1E 7.8 CMAS3_MYCTU
75 HHSearch 76.4156%-100 - C1 -1KPG 8.1 CMAS1_MYCTU
21 PsiBlast_CBE 76.1259% -95 - C1 -1KPH 8.5 CMAS1_MYCTU
7 PsiBlast_PDB 76.0659% -97 - C1 -1KPH 8.1 CMAS1_MYCTU
22 PsiBlast_CBE 75.6959% -96 - C1 -1KPH 8.6 CMAS1_MYCTU
24 PsiBlast_CBE 75.2359%-107 - C1 -1KP9 3.6 CMAS1_MYCTU
23 PsiBlast_CBE 75.0059% -96 - C1 -1KPH 8.4 CMAS1_MYCTU
9 PsiBlast_PDB 74.9256% -92 - C1 -1TPY 8.0 MMAA2_MYCTU
6 PsiBlast_PDB 74.9059%-103 - C1 -1KP9 3.8 CMAS1_MYCTU
25 PsiBlast_CBE 73.9255%-102 - C1 -1L1E 7.3 CMAS3_MYCTU
11 PsiBlast_PDB 72.6449% -91 - C1 -1KPI 8.3 CMAS2_MYCTU
12 PsiBlast_PDB 72.5949% -91 - C1 -3HEM 6.0 CMAS2_MYCTU
73 HHSearch 71.9250% -90 - C1 -3HEM 6.0 CMAS2_MYCTU