@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0733: (2016-04-25 )
MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKLGVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRGTDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVDAVGTMDEVFARALRALGK

Atome Classification :

(87 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AP5_A_3(1ZIN)
KAD_GEOSE
[Raw transfer]




AP5_A_4(1ZIO)
KAD_GEOSE
[Raw transfer]




AP5_A_3(4QBF)
KAD_BACSU
[Raw transfer]




AP5_B_4(3HPR)
KAD_ECOLI
[Raw transfer]




AP5_A_3(4QBH)
KAD_GEOSE
[Raw transfer]




AP5_A_3(3HPQ)
KAD_ECOLI
[Raw transfer]




AP5_B_7(4TYQ)
KAD_BACSU
[Raw transfer]




AP5_A_5(4QBI)
KAD_GEOSE
[Raw transfer]




AP5_B_7(4TYP)
KAD_BACSU
[Raw transfer]




AP5_A_4(3DKV)
KAD_BACSU
[Raw transfer]




AP5_A_7(3DL0)
KAD_BACSU
[Raw transfer]




AP5_A_3(4TYQ)
KAD_BACSU
[Raw transfer]




AP5_B_8(3DL0)
KAD_BACSU
[Raw transfer]




AP5_A_7(2ORI)
KAD_BACSU
[Raw transfer]




AP5_A_4(4MKG)
KAD_BACSU
[Raw transfer]




AP5_B_6(4NU0)
KAD_STRP2
[Raw transfer]




AP5_A_4(1ZIP)
KAD_GEOSE
[Raw transfer]




AP5_A_4(4NU0)
KAD_STRP2
[Raw transfer]




AP5_A_3(4MKH)
KAD_BACSU
[Raw transfer]




AP5_B_3(4QBG)
KAD_BACSU
[Raw transfer]




AP5_B_6(4QBH)
KAD_GEOSE
[Raw transfer]




AP5_B_8(2ORI)
KAD_BACSU
[Raw transfer]




AP5_A_3(4X8L)
KAD_ECOLI
[Raw transfer]




AP5_A_3(4X8O)
KAD_ECOLI
[Raw transfer]




AP5_B_6(4X8L)
KAD_ECOLI
[Raw transfer]




AP5_B_3(4QBG)
KAD_BACSU
[Raw transfer]




AP5_A_3(3FB4)
?
[Raw transfer]




AP5_B_4(1E4V)
KAD_ECOLI
[Raw transfer]




AP5_B_6(4X8O)
KAD_ECOLI
[Raw transfer]




AP5_B_4(3HPQ)
KAD_ECOLI
[Raw transfer]




AP5_A_3(3HPR)
KAD_ECOLI
[Raw transfer]




AP5_B_8(4QBI)
KAD_GEOSE
[Raw transfer]




AP5_B_9(3X2S)
?
[Raw transfer]




ANP_A_4(1ANK)
KAD_ECOLI
[Raw transfer]




AP5_B_4(1AKE)
KAD_ECOLI
[Raw transfer]




AP5_A_3(1S3G)
KAD_SPOGL
[Raw transfer]




AP5_A_9(4TYP)
KAD_BACSU
[Raw transfer]




AP5_A_3(1E4V)
KAD_ECOLI
[Raw transfer]




AP5_A_5(3X2S)
?
[Raw transfer]




AP5_A_3(1AKE)
KAD_ECOLI
[Raw transfer]




ANP_B_6(1ANK)
KAD_ECOLI
[Raw transfer]




AP5_A_6(2RGX)
KAD_AQUAE
[Raw transfer]




ADP_A_3(3SR0)
KAD_AQUAE
[Raw transfer]




ADP_B_6(4JL5)
KAD_AQUAE
[Raw transfer]




ADP_A_4(2CDN)
KAD_MYCTU
[Raw transfer]




ADP_B_7(3SR0)
KAD_AQUAE
[Raw transfer]




ADP_A_4(2CDN)
KAD_MYCTU
[Raw transfer]




ADP_B_6(4JLP)
KAD_AQUAE
[Raw transfer]




ATF_B_4(1DVR)
KAD2_YEAST
[Raw transfer]




ADP_B_6(4CF7)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JL8)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JLO)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4CF7)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JLB)
KAD_AQUAE
[Raw transfer]




ADP_B_7(4JKY)
KAD_AQUAE
[Raw transfer]




ADP_B_6(4JLA)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JLP)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JLD)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JLA)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JL6)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4IKE)
KAD_AQUAE
[Raw transfer]




ADP_B_6(4IKE)
KAD_AQUAE
[Raw transfer]




ADP_A_3(4JZK)
?
[Raw transfer]




ADP_B_6(4JLB)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JL5)
KAD_AQUAE
[Raw transfer]




ADP_B_6(4JL8)
KAD_AQUAE
[Raw transfer]




ADP_B_5(4JZK)
?
[Raw transfer]




ADP_B_6(2ECK)
KAD_ECOLI
[Raw transfer]




ADP_A_4(2ECK)
KAD_ECOLI
[Raw transfer]




ADP_A_11(3TLX)
?
[Raw transfer]




ADP_A_4(4JKY)
KAD_AQUAE
[Raw transfer]




ADP_A_4(4JL5)
KAD_AQUAE
[Raw transfer]




ADP_A_2(4K46)
KAD_PHOPR
[Raw transfer]




ADP_B_6(4JL6)
KAD_AQUAE
[Raw transfer]




ADP_B_9(3TLX)
?
[Raw transfer]




ADP_A_3(4JZK)
?
[Raw transfer]




AMP_A_3(1ANK)
KAD_ECOLI
[Raw transfer]




ADP_B_6(4JLO)
KAD_AQUAE
[Raw transfer]




AMP_B_5(1ANK)
KAD_ECOLI
[Raw transfer]




AMP_A_10(3TLX)
?
[Raw transfer]




SRT_A_3(2XB4)
?
[Raw transfer]




IMD_A_3(1AKY)
KAD2_YEAST
[Raw transfer]




IMD_A_3(1AKY)
KAD2_YEAST
[Raw transfer]




IMD_A_3(3AKY)
KAD2_YEAST
[Raw transfer]




EPE_A_3(4W5H)
KAD_STRP2
[Raw transfer]




1 PsiBlast_PDB 97.45100% -99 - C1 -2CDN 8.3 KAD_MYCTU
122 HHSearch 97.41100%-101 - C1 -2CDN 8.3 KAD_MYCTU
114 HHSearch 79.2744% -94 * C1 *4QBG 13.1 KAD_BACSU
2 PsiBlast_PDB 79.13100% -83 - C1 -1P4S - KAD_MYCTU -
9 PsiBlast_PDB 78.8842% -93 - C1 -4JLD 7.0 KAD_AQUAE
12 PsiBlast_PDB 77.9542% -97 - C1 -3SR0 7.7 KAD_AQUAE
27 PsiBlast_CBE 77.7842% -95 - C1 -4JKY 6.7 KAD_AQUAE
5 PsiBlast_PDB 77.5342% -94 - C1 -4JL6 6.6 KAD_AQUAE
116 HHSearch 77.3341%-103 - C1 -1AK2 - KAD2_BOVIN -
40 PsiBlast_CBE 77.0935% -87 - C1 -2AKY - KAD2_YEAST -
29 PsiBlast_CBE 76.8942% -92 - C1 -4CF7 8.4 KAD_AQUAE
15 PsiBlast_PDB 76.6041% -98 - C1 -4JLO 6.8 KAD_AQUAE
19 PsiBlast_PDB 76.5139% -86 - C1 -1ZIN 13.7 KAD_GEOSE
31 PsiBlast_CBE 76.5041% -99 - C1 -4JLP 8.4 KAD_AQUAE
38 PsiBlast_CBE 76.1835%-101 - C1 -1AK2 - KAD2_BOVIN -
4 PsiBlast_PDB 76.0742% -97 - C1 -4JL5 8.9 KAD_AQUAE
24 PsiBlast_CBE 76.0242% -93 - C1 -4JL8 8.5 KAD_AQUAE
118 HHSearch 75.9547% -98 - C1 -4JL5 8.6 KAD_AQUAE
26 PsiBlast_CBE 75.8442% -95 - C1 -4JL5 8.1 KAD_AQUAE
41 PsiBlast_CBE 75.7635% -85 - C1 -1AKY 3.7 KAD2_YEAST
33 PsiBlast_CBE 75.6740% -86 - C1 -4QBI 14.9 KAD_GEOSE
7 PsiBlast_PDB 75.6242% -92 - C1 -4JLA 6.6 KAD_AQUAE
16 PsiBlast_PDB 75.5441% -95 - C1 -4JLP 6.7 KAD_AQUAE
25 PsiBlast_CBE 75.4342% -95 - C1 -4JL6 6.7 KAD_AQUAE
8 PsiBlast_PDB 75.3342% -93 - C1 -4JLB 6.8 KAD_AQUAE
32 PsiBlast_CBE 75.1841% -98 - C1 -4JLO 7.1 KAD_AQUAE
23 PsiBlast_CBE 75.0642% -91 - C1 -4JLA 7.2 KAD_AQUAE
28 PsiBlast_CBE 74.8642% -95 - C1 -4IKE 6.9 KAD_AQUAE
22 PsiBlast_CBE 74.7942% -94 - C1 -4JLB 8.4 KAD_AQUAE
14 PsiBlast_PDB 74.7642% -92 - C1 -4CF7 6.9 KAD_AQUAE
13 PsiBlast_PDB 74.7342% -93 - C1 -4IKE 8.2 KAD_AQUAE
115 HHSearch 74.4041% -91 - C1 -1AKY 2.5 KAD2_YEAST
20 PsiBlast_PDB 74.2039% -87 - C1 -1ZIO 13.4 KAD_GEOSE
30 PsiBlast_CBE 74.0942% -94 - C1 -3SR0 7.8 KAD_AQUAE
51 PsiBlast_CBE 74.0639% -89 - C1 -4QBG 13.1 KAD_BACSU
6 PsiBlast_PDB 73.8642% -88 - C1 -4JL8 7.1 KAD_AQUAE
34 PsiBlast_CBE 73.6439% -85 - C1 -1ZIP 13.9 KAD_GEOSE
45 PsiBlast_CBE 73.5041% -83 - C1 -4MKG 14.2 KAD_BACSU
17 PsiBlast_PDB 73.3140% -90 - C1 -4QBI 13.9 KAD_GEOSE
71 PsiBlast_CBE 73.1939% -94 - C1 -4TYP 12.7 KAD_BACSU
44 PsiBlast_CBE 73.1840% -84 - C1 -4QBH 13.8 KAD_GEOSE
46 PsiBlast_CBE 73.0141% -86 - C1 -3DKV 13.8 KAD_BACSU
42 PsiBlast_CBE 72.9635% -84 - C1 -3AKY 3.7 KAD2_YEAST
47 PsiBlast_CBE 72.9135% -88 - C1 -1DVR 6.7 KAD2_YEAST
99 PsiBlast_CBE 72.7435% -77 - C1 -4NU0 13.4 KAD_STRP2
3 PsiBlast_PDB 72.2942% -96 - C1 -4JKY 7.2 KAD_AQUAE
10 PsiBlast_PDB 71.9542% -89 - C1 -2RGX 13.2 KAD_AQUAE
67 PsiBlast_CBE 71.5539% -87 - C1 -4TYQ 14.1 KAD_BACSU
43 PsiBlast_CBE 71.5240% -88 - C1 -4QBH 14.7 KAD_GEOSE
39 PsiBlast_CBE 71.3838% -87 - C1 -3FB4 14.2 ?
52 PsiBlast_CBE 69.9340% -81 - C1 -4QBF 13.1 KAD_BACSU
119 HHSearch 69.7545% -79 - C1 -4JZK 7.8 ?
66 PsiBlast_CBE 69.6739% -83 - C1 -4TYQ 13.9 KAD_BACSU
53 PsiBlast_CBE 69.1740% -86 - C1 -4MKH 13.8 KAD_BACSU
100 PsiBlast_CBE 69.1335% -78 - C1 -4NU0 13.8 KAD_STRP2
36 PsiBlast_CBE 68.9341% -84 - C1 -4K46 7.8 KAD_PHOPR
75 PsiBlast_CBE 68.6739% -76 - C1 -2ORI 13.1 KAD_BACSU
18 PsiBlast_PDB 68.6441% -75 - C1 -1S3G 13.2 KAD_SPOGL
123 HHSearch 68.1436% -92 - C1 -2XB4 2.4 ?
70 PsiBlast_CBE 67.8339% -84 - C1 -4TYP 11.6 KAD_BACSU
113 HHSearch 67.3038% -85 - C1 -3TLX 5.2 ?
73 PsiBlast_CBE 65.5739% -79 - C1 -4X8O 13.5 KAD_ECOLI
72 PsiBlast_CBE 65.4339% -77 - C1 -4X8O 13.5 KAD_ECOLI
76 PsiBlast_CBE 65.0939% -78 - C1 -2ORI 12.8 KAD_BACSU
58 PsiBlast_CBE 64.7339% -73 - C1 -3HPQ 12.8 KAD_ECOLI
98 PsiBlast_CBE 64.5435% -87 - C1 -4W5H 2.3 KAD_STRP2
59 PsiBlast_CBE 64.3839% -77 - C1 -3HPQ 13.0 KAD_ECOLI
84 PsiBlast_CBE 64.2739% -77 - C1 -4X8L 13.2 KAD_ECOLI
65 PsiBlast_CBE 64.0939% -78 - C1 -1AKE 12.1 KAD_ECOLI
85 PsiBlast_CBE 64.0539% -78 - C1 -4X8L 13.6 KAD_ECOLI
86 PsiBlast_CBE 64.0039% -77 - C1 -1E4V 13.5 KAD_ECOLI
49 PsiBlast_CBE 63.9140% -75 - C1 -3DL0 13.8 KAD_BACSU
50 PsiBlast_CBE 63.5140% -76 - C1 -3DL0 14.2 KAD_BACSU
57 PsiBlast_CBE 62.7239% -73 - C1 -3HPR 12.1 KAD_ECOLI
56 PsiBlast_CBE 62.2039% -76 - C1 -3HPR 11.4 KAD_ECOLI
68 PsiBlast_CBE 62.1939% -78 - C1 -3X2S 12.3 ?
63 PsiBlast_CBE 61.7739% -76 - C1 -1ANK 8.4 KAD_ECOLI
87 PsiBlast_CBE 61.0639% -79 - C1 -1E4V 13.7 KAD_ECOLI
55 PsiBlast_CBE 61.0639% -72 - C1 -4JZK 7.4 ?
69 PsiBlast_CBE 60.9939% -79 - C1 -3X2S 10.6 ?
88 PsiBlast_CBE 60.3735% -79 - C1 -3TLX 7.8 ?
64 PsiBlast_CBE 60.1939% -79 - C1 -1AKE 13.5 KAD_ECOLI
61 PsiBlast_CBE 59.1239% -75 - C1 -2ECK 6.7 KAD_ECOLI
60 PsiBlast_CBE 58.7639% -74 - C1 -2ECK 6.6 KAD_ECOLI
62 PsiBlast_CBE 58.6139% -77 - C1 -1ANK 7.0 KAD_ECOLI
54 PsiBlast_CBE 58.2939% -75 - C1 -4JZK 7.6 ?
89 PsiBlast_CBE 57.2535% -74 - C1 -3TLX 6.2 ?