@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0761c: (2016-04-25 )
MKTKGALIWEFNQPWSVEEIEIGDPRKDEVKIQMEAAGMCRSDHHLVTGDIPMAGFPVLGGHEGAGIVTEVGPGVDDFAPGDHVVLAFIPSCGKCPSCQAGMRNLCDLGAGLLAGESVTDGSFRIQARGQNVYPMTLLGTFSPYMVVHRSSVVKIDPSVPFEVACLVGCGVTTGYGSAVRTADVRPGDDVAIVGLGGVGMAALQGAVSAGARYVFAVEPVEWKRDQALKFGATHVYPDINAALMGIAEVTYGLMAQKVIITVGKLDGADVDSYLTITAKGGTCVLTAIGSLVDTQVTLNLAMLTLLQKNIQGTIFGGGNPHYDIPKLLSMYKAGKLNLDDMVTTAYKLEQINDGYQDMLNGKNIRGVIRYTDDDR

Atome Classification :

(55 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BRB_B_12(1HLD)
ADH1E_HORSE
[Raw transfer]




CHD_A_8(1EE2)
ADH1S_HORSE
[Raw transfer]




DMS_A_6(2JHF)
ADH1E_HORSE
[Raw transfer]




FXY_B_10(1U3W)
ADH1G_HUMAN
[Raw transfer]




IBO_A_6(2JHG)
ADH1E_HORSE
[Raw transfer]




BRB_A_11(1HLD)
ADH1E_HORSE
[Raw transfer]




FXY_A_9(1U3W)
ADH1G_HUMAN
[Raw transfer]




DMS_B_10(2OHX)
ADH1E_HORSE
[Raw transfer]




NAD_A_7(2OHX)
ADH1E_HORSE
[Raw transfer]




NAD_A_5(1HET)
ADH1E_HORSE
[Raw transfer]




IBO_B_10(2JHG)
ADH1E_HORSE
[Raw transfer]




NAD_A_5(1HEU)
ADH1E_HORSE
[Raw transfer]




NAD_A_5(2JHF)
ADH1E_HORSE
[Raw transfer]




NAD_B_9(2JHF)
ADH1E_HORSE
[Raw transfer]




NAD_A_7(1HT0)
ADH1G_HUMAN
[Raw transfer]




NAD_B_9(1HEU)
ADH1E_HORSE
[Raw transfer]




NAD_B_8(1U3W)
ADH1G_HUMAN
[Raw transfer]




NAD_B_8(1HT0)
ADH1G_HUMAN
[Raw transfer]




PFB_A_6(5CDS)
ADH1E_HORSE
[Raw transfer]




PFB_A_6(3OQ6)
ADH1E_HORSE
[Raw transfer]




PFB_A_6(4DWV)
ADH1E_HORSE
[Raw transfer]




PFB_B_12(5CDG)
ADH1E_HORSE
[Raw transfer]




PFB_B_12(5CDS)
ADH1E_HORSE
[Raw transfer]




PFB_B_10(1HLD)
ADH1E_HORSE
[Raw transfer]




PFB_A_6(5CDG)
ADH1E_HORSE
[Raw transfer]




PFB_B_12(3OQ6)
ADH1E_HORSE
[Raw transfer]




PFB_A_6(4NFH)
ADH1E_HORSE
[Raw transfer]




PFB_B_13(4DWV)
ADH1E_HORSE
[Raw transfer]




NAD_A_7(1U3W)
ADH1G_HUMAN
[Raw transfer]




NAD_A_7(1EE2)
ADH1S_HORSE
[Raw transfer]




PFB_B_13(4NFH)
ADH1E_HORSE
[Raw transfer]




PFB_A_9(1HLD)
ADH1E_HORSE
[Raw transfer]




PYZ_B_11(1DEH)
ADH1B_HUMAN
[Raw transfer]




DMS_B_10(6ADH)
ADH1E_HORSE
[Raw transfer]




PZO_A_8(1N8K)
ADH1E_HORSE
[Raw transfer]




ETF_A_6(4DXH)
ADH1E_HORSE
[Raw transfer]




PZO_B_10(1N8K)
ADH1E_HORSE
[Raw transfer]




PYZ_A_9(1HDY)
ADH1B_HUMAN
[Raw transfer]




DMS_A_8(2OXI)
ADH1E_HORSE
[Raw transfer]




ETF_B_13(4DXH)
ADH1E_HORSE
[Raw transfer]




PYZ_A_8(1N92)
ADH1E_HORSE
[Raw transfer]




PYZ_B_11(1HDY)
ADH1B_HUMAN
[Raw transfer]




PYZ_B_10(1N92)
ADH1E_HORSE
[Raw transfer]




PYZ_A_9(1DEH)
ADH1B_HUMAN
[Raw transfer]




DMS_A_8(6ADH)
ADH1E_HORSE
[Raw transfer]




DMS_B_10(2OXI)
ADH1E_HORSE
[Raw transfer]




PYZ_B_11(1HTB)
ADH1B_HUMAN
[Raw transfer]




NAD_A_4(1QLH)
ADH1E_HORSE
[Raw transfer]




PYZ_A_9(1HTB)
ADH1B_HUMAN
[Raw transfer]




MPD_A_4(1YE3)
ADH1E_HORSE
[Raw transfer]




15 PsiBlast_PDB 96.3537%-107 - C1 -1HDZ - ADH1B_HUMAN -
35 PsiBlast_CBE 96.1737%-109 - C1 -1U3U - ADH1B_HUMAN -
11 PsiBlast_PDB 96.0237%-110 - C1 -1U3U - ADH1B_HUMAN -
22 PsiBlast_CBE 95.9438%-110 - C1 -1HT0 7.2 ADH1G_HUMAN
9 PsiBlast_PDB 95.8137%-108 - C1 -1DEH 3.1 ADH1B_HUMAN
10 PsiBlast_PDB 95.8037%-107 - C1 -1HSZ - ADH1B_HUMAN -
39 PsiBlast_CBE 95.2537%-107 - C1 -1HDY 3.5 ADH1B_HUMAN
13 PsiBlast_PDB 95.2237%-109 - C1 -1HDY 3.4 ADH1B_HUMAN
38 PsiBlast_CBE 94.8837%-108 - C1 -1DEH 3.5 ADH1B_HUMAN
42 PsiBlast_CBE 94.7137%-108 - C1 -1HTB 3.0 ADH1B_HUMAN
34 PsiBlast_CBE 94.5437%-107 - C1 -1U3V - ADH1B_HUMAN -
1 PsiBlast_PDB 94.4038%-107 - C1 -1HT0 10.6 ADH1G_HUMAN
23 PsiBlast_CBE 94.0438%-106 - C1 -1EE2 7.5 ADH1S_HORSE
2 PsiBlast_PDB 94.0438%-105 - C1 -1U3W 8.0 ADH1G_HUMAN
3 PsiBlast_PDB 93.7438%-107 - C1 -1EE2 - ADH1S_HORSE -
41 PsiBlast_CBE 93.5837%-105 - C1 -1HDZ - ADH1B_HUMAN -
21 PsiBlast_CBE 93.4638%-104 - C1 -1U3W 7.1 ADH1G_HUMAN
37 PsiBlast_CBE 93.3137%-106 - C1 -1HDX - ADH1B_HUMAN -
12 PsiBlast_PDB 92.7337%-107 - C1 -1U3V - ADH1B_HUMAN -
7 PsiBlast_PDB 92.6937%-106 - C1 -1HDX - ADH1B_HUMAN -
16 PsiBlast_PDB 92.1737%-106 - C1 -1HTB 3.1 ADH1B_HUMAN
20 PsiBlast_PDB 90.3836%-103 - C1 -1N8K 2.8 ADH1E_HORSE
44 PsiBlast_CBE 90.1936%-104 - C1 -1N8K 2.7 ADH1E_HORSE
64 PsiBlast_CBE 87.7736%-101 - C1 -2OXI 3.0 ADH1E_HORSE
18 PsiBlast_PDB 87.7236%-100 - C1 -1QLH 5.0 ADH1E_HORSE
43 PsiBlast_CBE 87.3336%-101 - C1 -4NFH 3.2 ADH1E_HORSE
77 PsiBlast_CBE 86.7636%-100 - C1 -1N92 3.5 ADH1E_HORSE
92 PsiBlast_CBE 86.7436%-101 - C1 -1HLD 3.6 ADH1E_HORSE
69 PsiBlast_CBE 86.2236%-101 - C1 -2JHG 3.9 ADH1E_HORSE
96 PsiBlast_CBE 86.2136%-102 - C1 -1HEU 5.8 ADH1E_HORSE
66 PsiBlast_CBE 86.1736%-100 - C1 -2OHX 3.4 ADH1E_HORSE
59 PsiBlast_CBE 85.9736%-101 - C1 -4DWV 3.4 ADH1E_HORSE
72 PsiBlast_CBE 85.9036% -99 - C1 -1YE3 3.9 ADH1E_HORSE
58 PsiBlast_CBE 85.7736%-100 - C1 -4DWV 3.1 ADH1E_HORSE
17 PsiBlast_PDB 85.7336%-101 - C1 -4NFH 3.4 ADH1E_HORSE
98 PsiBlast_CBE 85.6736%-101 - C1 -1HET 7.6 ADH1E_HORSE
57 PsiBlast_CBE 85.4736%-101 - C1 -4DXH 2.5 ADH1E_HORSE
14 PsiBlast_PDB 85.3336%-101 - C1 -5CDG 3.3 ADH1E_HORSE
47 PsiBlast_CBE 85.2836%-100 - C1 -3OQ6 3.1 ADH1E_HORSE
56 PsiBlast_CBE 85.1136%-101 - C1 -4DXH 2.5 ADH1E_HORSE
65 PsiBlast_CBE 84.9836% -98 - C1 -2OXI 3.2 ADH1E_HORSE
70 PsiBlast_CBE 84.8636%-100 - C1 -2JHF 6.6 ADH1E_HORSE
40 PsiBlast_CBE 84.7336%-100 - C1 -5CDG 3.1 ADH1E_HORSE
48 PsiBlast_CBE 84.5436%-101 - C1 -3OQ6 3.3 ADH1E_HORSE
67 PsiBlast_CBE 84.4136%-101 - C1 -2OHX 11.2 ADH1E_HORSE
95 PsiBlast_CBE 84.3136%-101 - C1 -1HEU 8.5 ADH1E_HORSE
91 PsiBlast_CBE 84.2436% -99 - C1 -1HLD 3.0 ADH1E_HORSE
78 PsiBlast_CBE 84.1836%-100 - C1 -1N92 3.4 ADH1E_HORSE
46 PsiBlast_CBE 84.0636% -99 - C1 -5CDS 3.3 ADH1E_HORSE
111 HHSearch 83.4136% -99 * C1 *2JHF 3.5 ADH1E_HORSE
71 PsiBlast_CBE 83.2136% -99 - C1 -2JHF 6.1 ADH1E_HORSE
68 PsiBlast_CBE 83.1436% -99 - C1 -2JHG 3.9 ADH1E_HORSE
45 PsiBlast_CBE 82.7536%-100 - C1 -5CDS 3.0 ADH1E_HORSE
52 PsiBlast_CBE 80.7936% -98 - C1 -6ADH 3.4 ADH1E_HORSE
51 PsiBlast_CBE 76.9736% -97 - C1 -6ADH 3.4 ADH1E_HORSE