@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0865: (2016-04-26 )
MSTRSARIVVVSSRAAAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADGNPVGEALHDAVNAGVDVIITSGGTGISPTDTTPEHTVAVLDYVIPGLADAIRRSGLPKVPTSVLSRGVCGVAGRTLIINLPGSPGGVRDGLGVLADVLDHALEQIAGGDHPR

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_F_10(4TWG)
?
[Raw transfer]




CIT_A_7(4TWG)
?
[Raw transfer]




EDO_C_10(3MCI)
?
[Raw transfer]




AMP_A_3(1UUY)

[Raw transfer]




EDO_E_7(3MCJ)
?
[Raw transfer]




EDO_A_4(3MCI)
?
[Raw transfer]




1 PsiBlast_PDB 97.16100%-132 - C4 -2G4R - ? -
24 PsiBlast_CBE 92.1280%-127 - C4 -4TWG - ? -
2 PsiBlast_PDB 91.8980%-129 - C4 -4TWG 2.6 ?
23 PsiBlast_CBE 90.7180%-124 - C4 -4TWG - ? -
21 PsiBlast_CBE 89.2380%-125 - C4 -4TWG 3.1 ?
70 HHSearch 88.0976%-124 - C4 -3PZY - ? -
3 PsiBlast_PDB 88.0976%-124 - C4 -3PZY - ? -
22 PsiBlast_CBE 86.9980%-126 - C4 -4TWG - ? -
4 PsiBlast_PDB 86.0075%-121 - C4 -3OI9 - ? -
12 PsiBlast_PDB 73.3143%-128 - C4 -3RFQ - ? -
31 PsiBlast_CBE 72.0243%-122 - C4 -3RFQ - ? -
69 HHSearch 71.1938%-122 - C4 -3RFQ - ? -
63 HHSearch 70.6641%-114 - C4 -2IS8 - ? -
5 PsiBlast_PDB 69.4742%-112 - C4 -2IS8 - ? -
72 HHSearch 69.1234%-111 - C4 -4NWO - ? -
66 HHSearch 67.5928%-112 - C4 -3IWT - ? -
6 PsiBlast_PDB 67.5742%-109 - C4 -3MCH - ? -
53 Fugue 67.4630%-105 - C4 -1JLJ - GEPH_HUMAN -
26 PsiBlast_CBE 67.4142%-107 - C4 -2IS8 - ? -
25 PsiBlast_CBE 67.2642%-106 - C4 -3MCH - ? -
29 PsiBlast_CBE 63.1034% -96 - C4 -3MCI 2.9 ?
9 PsiBlast_PDB 62.9334% -98 - C4 -3MCI 2.9 ?
28 PsiBlast_CBE 62.5834% -98 - C4 -3MCJ 3.0 ?
19 PsiBlast_PDB 52.2243%-116 - C4 -1UUY 3.8