@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv0902c: (2016-04-26 )
MNILSRIFARTPSLRTRVVVATAIGAAIPVLIVGTVVWVGITNDRKERLDRRLDEAAGFAIPFVPRGLDEIPRSPNDQDALITVRRGNVIKSNSDITLPKLQDDYADTYVRGVRYRVRTVEIPGPEPTSVAVGATYDATVAETNNLHRRVLLICTFAIGAAAVFAWLLAAFAVRPFKQLAEQTRSIDAGDEAPRVEVHGASEAIEIAEAMRGMLQRIWNEQNRTKEALASARDFAAVSSHELRTPLTAMRTNLEVLSTLDLPDDQRKEVLNDVIRTQSRIEATLSALERLAQGELSTSDDHVPVDITDLLDRAAHDAARIYPDLDVSLVPSPTCIIVGLPAGLRLAVDNAIANAVKHGGATLVQLSAVSSRAGVEIAIDDNGSGVPEGERQVVFERFSRGSTASHSGSGLGLALVAQQAQLHGGTASLENSPLGGARLVLRLPGPS

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRS_D_4(1YS3)
PRRB_MYCTU
[Raw transfer]




TRS_A_4(1YSR)
PRRB_MYCTU
[Raw transfer]




TRS_C_6(1YSR)
PRRB_MYCTU
[Raw transfer]




22 PsiBlast_CBE 87.39100%-107 - C4 -1YSR 2.1 PRRB_MYCTU
1 PsiBlast_PDB 87.10100%-105 - C4 -1YS3 - PRRB_MYCTU -
23 PsiBlast_CBE 86.18100%-102 - C4 -1YS3 - -
21 PsiBlast_CBE 85.97100%-101 - C4 -1YSR - -
24 PsiBlast_CBE 85.85100%-106 - C4 -1YS3 3.0 PRRB_MYCTU
2 PsiBlast_PDB 85.73100%-103 - C4 -1YSR - PRRB_MYCTU -
35 HHSearch 70.2321% -53 - C4 -4I5S - ? -
11 PsiBlast_PDB 69.3629% -79 - C4 -4JAU - ? -
13 PsiBlast_PDB 68.7830% -73 - C4 -4JAV - ? -
12 PsiBlast_PDB 66.7430% -75 - C4 -3DGE - ? -
14 PsiBlast_PDB 66.0330% -81 - C4 -2C2A - ? -
10 PsiBlast_PDB 65.1529% -70 - C4 -4JAS - ? -
47 HHSearch 63.8928% -70 - C4 -2C2A - ? -
8 PsiBlast_PDB 63.8331% -60 - C4 -4CB0 - CPXA_ECOLI -
7 PsiBlast_PDB 62.9531% -64 - C4 -4BIV - CPXA_ECOLI -
5 PsiBlast_PDB 62.7131% -61 - C4 -4BIX - CPXA_ECOLI -
3 PsiBlast_PDB 62.5931% -62 - C4 -4BIU - CPXA_ECOLI -
4 PsiBlast_PDB 62.2731% -63 - C4 -4BIW - CPXA_ECOLI -
6 PsiBlast_PDB 61.8931% -63 - C4 -4BIY - CPXA_ECOLI -
54 HHSearch 61.88100% -78 - C4 -1YSR 2.5 PRRB_MYCTU