@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1050: (2016-04-28 )
MARQRFRDQVVLITGASSGIGEATAKAFAREGAVVALAARREGALRRVAREIEAAGGRAMVAPLDVSSSESVRAMVADVVGEFGRIDVVFNNAGVSLVGPVDAETFLDDTREMLEIDYLGTVRVVREVLPIMKQQRSGRIMNMSSVVGRKAFARFAGYSSAMHAIAGFSDALRQELRGSGIAVSVIHPALTQTPLLANVDPADMPPPFRSLTPIPVHWVAAAVLDGVARRRARVVVPFQPRLLMVGDAFSPRYGDRVVRLLESKIFGRLIGSYRGSVYRHQPTESAKAQAAQPERGYSSAR

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NDP_A_5(2JAP)
?
[Raw transfer]




NAP_D_8(3P19)
?
[Raw transfer]




NDP_A_5(2JAH)
?
[Raw transfer]




NDP_D_11(2JAP)
?
[Raw transfer]




NDP_C_9(2JAP)
?
[Raw transfer]




NAP_A_5(3P19)
?
[Raw transfer]




NDP_B_7(2JAP)
?
[Raw transfer]




125 HHSearch 85.5428% -97 - C1 -3PXX - ? -
18 PsiBlast_PDB 82.0541%-105 - C1 -2JAH 12.7 ?
26 PsiBlast_CBE 81.2142%-101 - C1 -2JAP 13.2 ?
25 PsiBlast_CBE 80.2642%-100 - C1 -2JAP 13.4 ?
6 PsiBlast_PDB 79.6342%-101 - C1 -2JAP 13.6 ?
27 PsiBlast_CBE 78.8442%-102 - C1 -2JAP 13.2 ?
37 PsiBlast_CBE 77.8836% -92 - C1 -1XR3 - ACT3_STRCO -
5 PsiBlast_PDB 77.8637% -96 - C1 -3RI3 - ACT3_STRCO -
33 PsiBlast_CBE 77.2036% -94 - C1 -2RH4 - ACT3_STRCO -
116 HHSearch 77.0328% -97 - C1 -3TSC - ? -
35 PsiBlast_CBE 76.7136% -95 - C1 -4DC1 - ACT3_STRCO -
28 PsiBlast_CBE 76.6336% -96 - C1 -4DBZ - ACT3_STRCO -
111 HHSearch 76.6125%-107 - C1 -4RGB - ? -
34 PsiBlast_CBE 76.3536% -94 - C1 -1W4Z - ACT3_STRCO -
10 PsiBlast_PDB 76.1136% -94 - C1 -2RHC - ACT3_STRCO -
70 PsiBlast_CBE 76.1037%-101 - C1 -4DMM - ? -
36 PsiBlast_CBE 75.2336% -93 - C1 -4DC0 - ACT3_STRCO -
123 HHSearch 74.7927% -99 - C1 -2CFC - HCDR_XANP2 -
23 PsiBlast_CBE 74.5237% -94 - C1 -3QRW - ACT3_STRCO -
30 PsiBlast_CBE 74.0332%-103 - C1 -4NBU - ? -
40 PsiBlast_CBE 63.5631% -99 - C1 -3P19 12.7 ?
20 PsiBlast_PDB 63.0231% -97 - C1 -3P19 11.5 ?