@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1144: (2016-04-28 )
MKTKDAVAVVTGGASGLGLATTKRLLDAGAQVVVVDLRGDDVVGGLGDRARFAQADVTDEAAVSNALELADSLGPVRVVVNCAGTGNAIRVLSRDGVFPLAAFRKIVDINLVGTFNVLRLGAERIAKTEPIGEERGVIINTASVAAFDGQIGQAAYSASKGGVVGMTLPIARDLASKLIRVVTIAPGLFDTPLLASLPAEAKASLGQQVPHPSRLGNPDEYGALVLHIIENPMLNGEVIRLDGAIRMAPR

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TDT_H_8(1U7T)
HCD2_HUMAN
[Raw transfer]




NAD_C_7(1E3W)
HCD2_RAT
[Raw transfer]




TDT_G_7(1U7T)
HCD2_HUMAN
[Raw transfer]




NAD_D_8(1E6W)
HCD2_RAT
[Raw transfer]




NAI_A_4(1ZJY)
?
[Raw transfer]




NAD_F_6(1U7T)
HCD2_HUMAN
[Raw transfer]




NAD_B_6(1E6W)
HCD2_RAT
[Raw transfer]




NAD_A_3(1ZK1)
?
[Raw transfer]




NAD_D_8(1E3W)
HCD2_RAT
[Raw transfer]




NAD_C_9(2CFC)
HCDR_XANP2
[Raw transfer]




NAD_A_5(1E6W)
HCD2_RAT
[Raw transfer]




NAD_D_11(2CFC)
HCDR_XANP2
[Raw transfer]




NAD_A_5(2CFC)
HCDR_XANP2
[Raw transfer]




NAD_A_5(1E3W)
HCD2_RAT
[Raw transfer]




NAD_C_7(1E6W)
HCD2_RAT
[Raw transfer]




NAD_A_3(4B79)
?
[Raw transfer]




NAD_A_3(2O23)
HCD2_HUMAN
[Raw transfer]




NAD_B_6(1E3W)
HCD2_RAT
[Raw transfer]




NAD_A_5(1E3S)
HCD2_RAT
[Raw transfer]




TDT_E_5(1U7T)
HCD2_HUMAN
[Raw transfer]




NAD_B_6(1E3S)
HCD2_RAT
[Raw transfer]




NAD_C_7(1E3S)
HCD2_RAT
[Raw transfer]




NAD_B_7(2CFC)
HCDR_XANP2
[Raw transfer]




NAD_D_8(1E3S)
HCD2_RAT
[Raw transfer]




NAD_D_18(4WEC)
?
[Raw transfer]




NAD_C_15(4WEC)
?
[Raw transfer]




NAD_B_10(4WEC)
?
[Raw transfer]




NAP_A_4(1UZN)
FABG_MYCTU
[Raw transfer]




ADN_B_4(1UAY)
?
[Raw transfer]




NAD_A_5(4WEC)
?
[Raw transfer]




ADN_A_3(1UAY)
?
[Raw transfer]




KPC_D_12(2CFC)
HCDR_XANP2
[Raw transfer]




KPC_C_10(2CFC)
HCDR_XANP2
[Raw transfer]




EST_L_9(1E6W)
HCD2_RAT
[Raw transfer]




AC0_A_4(1ZK4)
?
[Raw transfer]




130 HHSearch 94.3088%-122 - C1 -3TL3 - ? -
1 PsiBlast_PDB 93.5886%-122 - C1 -3TL3 - ? -
21 PsiBlast_CBE 91.4986%-115 - C1 -3TL3 - ? -
30 PsiBlast_CBE 86.6958%-109 - C1 -1E6W 12.1 HCD2_RAT
23 PsiBlast_CBE 85.6860%-106 - C1 -1U7T 15.1 HCD2_HUMAN
24 PsiBlast_CBE 85.6060%-106 - C1 -1U7T 10.3 HCD2_HUMAN
6 PsiBlast_PDB 85.2560%-107 - C1 -2O23 11.3 HCD2_HUMAN
2 PsiBlast_PDB 85.0660%-106 - C1 -1U7T 15.4 HCD2_HUMAN
33 PsiBlast_CBE 84.9958%-109 - C1 -1E3W 11.9 HCD2_RAT
22 PsiBlast_CBE 84.9660%-105 - C1 -1U7T 15.8 HCD2_HUMAN
25 PsiBlast_CBE 84.4158%-107 - C1 -1E3W 11.8 HCD2_RAT
31 PsiBlast_CBE 84.0358%-113 - C1 -1E6W 12.0 HCD2_RAT
5 PsiBlast_PDB 83.9058%-107 - C1 -1E6W 11.9 HCD2_RAT
26 PsiBlast_CBE 83.1958%-111 - C1 -1E3W 12.0 HCD2_RAT
28 PsiBlast_CBE 83.0658%-110 - C1 -1E3S 10.7 HCD2_RAT
32 PsiBlast_CBE 82.6858%-112 - C1 -1E6W 11.8 HCD2_RAT
4 PsiBlast_PDB 82.0658%-110 - C1 -1E3W 11.7 HCD2_RAT
27 PsiBlast_CBE 82.0458%-110 - C1 -1E3S 11.2 HCD2_RAT
3 PsiBlast_PDB 82.0458%-112 - C1 -1E3S 10.7 HCD2_RAT
10 PsiBlast_PDB 81.9758%-106 - C1 -1UAY 6.3 ?
29 PsiBlast_CBE 81.7758%-110 - C1 -1E3S 10.8 HCD2_RAT
42 PsiBlast_CBE 80.6558%-108 - C1 -1UAY 6.3 ?
19 PsiBlast_PDB 61.8133% -93 - C1 -1ZJY 7.3 ?
65 PsiBlast_CBE 61.3133% -92 - C1 -1ZK1 7.9 ?
84 PsiBlast_CBE 61.2333% -93 - C1 -1ZK4 2.1 ?
103 PsiBlast_CBE 61.0732%-101 - C1 -1UZN 5.2 FABG_MYCTU
90 PsiBlast_CBE 60.2635% -95 - C1 -4WEC 9.3 ?
92 PsiBlast_CBE 59.7935% -93 - C1 -4WEC 5.8 ?
91 PsiBlast_CBE 59.0735% -92 - C1 -4WEC 7.3 ?
93 PsiBlast_CBE 59.0135% -92 - C1 -4WEC 5.4 ?
118 PsiBlast_CBE 47.3735% -90 - C1 -2CFC 8.3 HCDR_XANP2
117 PsiBlast_CBE 46.9435% -90 - C1 -2CFC 7.0 HCDR_XANP2
116 PsiBlast_CBE 46.9035% -89 - C1 -2CFC 7.6 HCDR_XANP2
115 PsiBlast_CBE 46.4635% -90 - C1 -2CFC 8.9 HCDR_XANP2
100 PsiBlast_CBE 43.2435% -73 - C1 -4B79 11.0 ?