@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1187: (2016-04-29 )
MDAITQVPVPANEPVHDYAPKSPERTRLRTELASLADHPIDLPHVIGGRHRMGDGERIDVVQPHRHAARLGTLTNATHADAAAAVEAAMSAKSDWAALPFDERAAVFLRAADLLAGPWREKIAAATMLGQSKSVYQAEIDAVCELIDFWRFNVAFARQILEQQPISGPGEWNRIDYRPLDGFVYAITPFNFTSIAGNLPTAPALMGNTVIWKPSITQTLAAYLTMQLLEAAGLPPGVINLVTGDGFAVSDVALADPRLAGIHFTGSTATFGHLWQWVGTNIGRYHSYPRLVGETGGKDFVVAHASARPDVLRTALIRGAFDYQGQKCSAVSRAFIAHSVWQRMGDELLAKAAELRYGDITDLSNYGGALIDQRAFVKNVDAIERAKGAAAVTVAVGGEYDDSEGYFVRPTVLLSDDPTDESFVIEYFGPLLSVHVYPDERYEQILDVIDTGSRYALTGAVIADDRQAVLTALDRLRFAAGNFYVNDKPTGAVVGRQPFGGARGSGTNDKAGSPLNLLRWTSARSIKETFVAATDHIYPHMAVD

Atome Classification :

(62 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SIN_B_6(4LH2)
AL4A1_MOUSE
[Raw transfer]




SIN_A_4(4LH2)
AL4A1_MOUSE
[Raw transfer]




GUA_B_6(4LH3)
AL4A1_MOUSE
[Raw transfer]




SER_B_8(2EJL)
?
[Raw transfer]




GLU_A_3(2BHQ)
?
[Raw transfer]




GLU_B_6(3V9K)
AL4A1_MOUSE
[Raw transfer]




GUA_A_4(4LH3)
AL4A1_MOUSE
[Raw transfer]




GLU_B_4(2BHQ)
?
[Raw transfer]




GLU_A_5(3V9K)
AL4A1_MOUSE
[Raw transfer]




PRO_A_6(4E3X)
AL4A1_MOUSE
[Raw transfer]




PRO_A_6(4E3X)
AL4A1_MOUSE
[Raw transfer]




MLA_A_3(4LH1)
AL4A1_MOUSE
[Raw transfer]




PRO_A_7(2EIW)
?
[Raw transfer]




ALA_B_11(2EIT)
?
[Raw transfer]




PRO_B_11(4E3X)
AL4A1_MOUSE
[Raw transfer]




SER_A_7(2EJL)
?
[Raw transfer]




MLA_B_5(4LH1)
AL4A1_MOUSE
[Raw transfer]




PRO_B_8(2EIW)
?
[Raw transfer]




ALA_B_8(2EJD)
?
[Raw transfer]




FLC_A_3(2IY6)
?
[Raw transfer]




ALA_A_7(2EJD)
?
[Raw transfer]




FLC_B_11(2IY6)
?
[Raw transfer]




DPR_A_7(2EJ6)
?
[Raw transfer]




GLY_B_4(2J5N)
?
[Raw transfer]




DPR_B_8(2EJ6)
?
[Raw transfer]




NAD_A_2(4IHI)
?
[Raw transfer]




GLV_A_3(4LH0)
AL4A1_MOUSE
[Raw transfer]




GLV_B_6(4LH0)
AL4A1_MOUSE
[Raw transfer]




NAD_B_12(2EIT)
?
[Raw transfer]




NAP_A_9(2EHQ)
?
[Raw transfer]




NAP_B_10(2EHQ)
?
[Raw transfer]




NAD_B_6(3V9L)
AL4A1_MOUSE
[Raw transfer]




NAD_A_5(3V9L)
AL4A1_MOUSE
[Raw transfer]




NAD_A_10(2EIT)
?
[Raw transfer]




NAD_A_3(2BHP)
?
[Raw transfer]




NAD_B_13(2J5N)
?
[Raw transfer]




NAD_B_10(2BJK)
?
[Raw transfer]




NAD_A_10(2EII)
?
[Raw transfer]




NAD_A_5(2J40)
?
[Raw transfer]




NAD_B_12(2EHU)
?
[Raw transfer]




NAD_B_12(2EII)
?
[Raw transfer]




NAD_B_11(2J40)
?
[Raw transfer]




NAD_B_15(2BHP)
?
[Raw transfer]




NAD_A_10(2EHU)
?
[Raw transfer]




NAD_A_5(2J5N)
?
[Raw transfer]




NAD_A_3(2BJK)
?
[Raw transfer]




NAD_A_3(4OE4)
PUT2_YEAST
[Raw transfer]




NAD_A_2(4JDC)
?
[Raw transfer]




NAD_A_2(4JDC)
?
[Raw transfer]




NAD_B_4(4OE4)
PUT2_YEAST
[Raw transfer]




25 PsiBlast_CBE 98.6399% -97 - C3 -4LEM - ? -
28 PsiBlast_CBE 98.5999% -97 - C3 -4LEM - ? -
26 PsiBlast_CBE 98.3399% -96 - C3 -4LEM - ? -
1 PsiBlast_PDB 98.3199% -97 - C3 -4IHI 9.7 ?
24 PsiBlast_CBE 98.2899% -96 - C3 -4NS3 - ? -
22 PsiBlast_CBE 98.1399% -99 - C3 -4NS3 - ? -
5 PsiBlast_PDB 98.0399% -96 - C3 -4NS3 - ? -
4 PsiBlast_PDB 97.9199% -95 - C3 -4LEM - ? -
27 PsiBlast_CBE 97.8599% -95 - C3 -4LEM - ? -
3 PsiBlast_PDB 97.5899% -95 - C3 -4JDC 6.6 ?
21 PsiBlast_CBE 97.5099% -96 - C3 -4NS3 - ? -
23 PsiBlast_CBE 97.2599% -95 - C3 -4NS3 - ? -
103 HHSearch 96.5799% -93 - C3 -4JDC 6.6 ?
2 PsiBlast_PDB 81.5899% -59 - C3 -4IDS - ? -
9 PsiBlast_PDB 76.9745% -88 - C3 -3V9I - AL4A1_HUMAN -
37 PsiBlast_CBE 76.5245% -80 - C3 -4E3X 3.4 AL4A1_MOUSE
17 PsiBlast_PDB 76.4145% -77 - C3 -4LH2 3.1 AL4A1_MOUSE
14 PsiBlast_PDB 76.2845% -78 - C3 -4LGZ - AL4A1_MOUSE -
8 PsiBlast_PDB 76.2545% -80 - C3 -3V9H - AL4A1_HUMAN -
16 PsiBlast_PDB 76.2145% -78 - C3 -4LH1 2.7 AL4A1_MOUSE
34 PsiBlast_CBE 76.1345% -79 - C3 -4LH1 2.6 AL4A1_MOUSE
12 PsiBlast_PDB 76.0345% -77 - C3 -3V9L 8.2 AL4A1_MOUSE
38 PsiBlast_CBE 75.9845% -79 - C3 -3V9L 8.4 AL4A1_MOUSE
18 PsiBlast_PDB 75.9445% -79 - C3 -4LH3 3.5 AL4A1_MOUSE
13 PsiBlast_PDB 75.8545% -79 - C3 -4E3X 3.2 AL4A1_MOUSE
32 PsiBlast_CBE 75.7145% -80 - C3 -4LH3 3.5 AL4A1_MOUSE
33 PsiBlast_CBE 75.6445% -80 - C3 -4LH2 4.1 AL4A1_MOUSE
35 PsiBlast_CBE 75.6045% -79 - C3 -4LH0 2.6 AL4A1_MOUSE
11 PsiBlast_PDB 75.4745% -78 - C3 -3V9K 3.7 AL4A1_MOUSE
41 PsiBlast_CBE 75.4446% -97 - C3 -4OE4 6.1 PUT2_YEAST
39 PsiBlast_CBE 75.3445% -78 - C3 -3V9K 3.8 AL4A1_MOUSE
15 PsiBlast_PDB 75.3345% -78 - C3 -4LH0 2.6 AL4A1_MOUSE
104 HHSearch 73.5544% -73 - C3 -4E3X 3.2 AL4A1_MOUSE
19 PsiBlast_PDB 73.2946% -96 - C3 -4OE4 7.7 PUT2_YEAST
63 PsiBlast_CBE 70.8831% -77 - C3 -2EHQ 8.7 ?
75 PsiBlast_CBE 70.4331% -77 - C3 -2J40 7.4 ?
51 PsiBlast_CBE 70.4231% -76 - C3 -2J5N 8.1 ?
77 PsiBlast_CBE 70.3031% -77 - C3 -2EJL 2.5 ?
80 PsiBlast_CBE 70.1431% -77 - C3 -2EJD 2.6 ?
62 PsiBlast_CBE 70.1231% -75 - C3 -2EHU 8.7 ?
58 PsiBlast_CBE 70.0931% -76 - C3 -2EIT 7.8 ?
53 PsiBlast_CBE 70.0831% -76 - C3 -2IY6 3.4 ?
79 PsiBlast_CBE 70.0531% -77 - C3 -2EJD 2.5 ?
55 PsiBlast_CBE 69.9931% -76 - C3 -2EJ6 2.6 ?
61 PsiBlast_CBE 69.9831% -75 - C3 -2EHU 8.1 ?
78 PsiBlast_CBE 69.8931% -77 - C3 -2EJL 2.4 ?
64 PsiBlast_CBE 69.8831% -76 - C3 -2EHQ 9.1 ?
54 PsiBlast_CBE 69.8831% -77 - C3 -2IY6 3.4 ?
60 PsiBlast_CBE 69.8431% -76 - C3 -2EII 8.4 ?
72 PsiBlast_CBE 69.7431% -76 - C3 -2EIW 3.3 ?
71 PsiBlast_CBE 69.7431% -77 - C3 -2EIW 3.4 ?
56 PsiBlast_CBE 69.7431% -80 - C3 -2EJ6 3.1 ?
68 PsiBlast_CBE 69.7231% -77 - C3 -2BHQ 3.7 ?
67 PsiBlast_CBE 69.5531% -77 - C3 -2BHQ 3.7 ?
52 PsiBlast_CBE 69.5431% -75 - C3 -2J5N 8.9 ?
69 PsiBlast_CBE 69.5031% -74 - C3 -2BHP 8.7 ?
70 PsiBlast_CBE 69.4631% -76 - C3 -2BHP 8.2 ?
76 PsiBlast_CBE 69.3131% -76 - C3 -2J40 8.4 ?
57 PsiBlast_CBE 69.2431% -75 - C3 -2EIT 7.1 ?
59 PsiBlast_CBE 69.1131% -75 - C3 -2EII 8.1 ?
66 PsiBlast_CBE 68.9831% -74 - C3 -2BJK 8.6 ?
65 PsiBlast_CBE 68.3031% -73 - C3 -2BJK 8.6 ?