@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1207: (2016-04-29 )
MRSTPPASAGRSTPPALAGHSTPPALAGHSTLCGRPVAGDRALIMAIVNRTPDSFYDKGATFSDAAARDAVHRAVADGADVIDVGGVKAGPGERVDVDTEITRLVPFIEWLRGAYPDQLISVDTWRAQVAKAACAAGADLINDTWGGVDPAMPEVAAEFGAGLVCAHTGGALPRTRPFRVSYGTTTRGVVDAVISQVTAAAERAVAAGVAREKVLIDPAHDFGKNTFHGLLLLRHVADLVMTGWPVLMALSNKDVVGETLGVDLTERLEGTLAATALAAAAGARMFRVHEVAATRRVLEMVASIQGVRPPTRTVRGLA

Atome Classification :

(70 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HH2_A_3(3TZF)
?
[Raw transfer]




HH2_B_5(3TZF)
?
[Raw transfer]




PMM_N_14(1TWZ)
?
[Raw transfer]




PMM_A_3(1EYE)
DHPS1_MYCTU
[Raw transfer]




PMM_A_2(2BMB)
FOL1_YEAST
[Raw transfer]




PMM_A_3(1EYE)
DHPS1_MYCTU
[Raw transfer]




2PH_C_3(1AJ2)
DHPS_ECOLI
[Raw transfer]




78H_B_16(2Y5S)
?
[Raw transfer]




0J5_B_8(4DAI)
?
[Raw transfer]




680_O_15(1TX2)
?
[Raw transfer]




XTZ_A_3(3TYE)
?
[Raw transfer]




0HY_B_13(4D8A)
?
[Raw transfer]




0J4_A_3(4DAF)
?
[Raw transfer]




0J4_B_8(4DAF)
?
[Raw transfer]




0HY_A_7(4D8A)
?
[Raw transfer]




680_P_16(1TX2)
?
[Raw transfer]




Z25_B_8(4DB7)
?
[Raw transfer]




78H_A_3(2Y5S)
?
[Raw transfer]




78H_A_3(2Y5S)
?
[Raw transfer]




B52_A_3(3H21)
?
[Raw transfer]




PT1_O_15(1TX0)
?
[Raw transfer]




B52_B_7(3H21)
?
[Raw transfer]




0J2_A_7(4D8Z)
?
[Raw transfer]




B57_A_3(3H2A)
?
[Raw transfer]




0J5_A_3(4DAI)
?
[Raw transfer]




78H_B_8(3TYA)
?
[Raw transfer]




B55_A_3(3H24)
?
[Raw transfer]




B53_A_3(3H22)
?
[Raw transfer]




B63_A_3(3H2O)
?
[Raw transfer]




PT1_A_3(3TYU)
?
[Raw transfer]




Z17_B_14(4D9P)
?
[Raw transfer]




0J2_B_13(4D8Z)
?
[Raw transfer]




PMM_A_4(2VEG)
DHPS_STRR6
[Raw transfer]




PT1_P_16(1TX0)
?
[Raw transfer]




XHP_B_10(3TYC)
?
[Raw transfer]




B61_A_3(3H2M)
?
[Raw transfer]




PH2_C_3(1AJ0)
DHPS_ECOLI
[Raw transfer]




B57_B_7(3H2A)
?
[Raw transfer]




XHP_A_3(3TYZ)
?
[Raw transfer]




PH2_C_3(1AJ0)
DHPS_ECOLI
[Raw transfer]




Z25_A_3(4DB7)
?
[Raw transfer]




XHP_B_7(3TYZ)
?
[Raw transfer]




B56_A_3(3H26)
?
[Raw transfer]




XHP_A_4(3TYD)
?
[Raw transfer]




Z17_A_8(4D9P)
?
[Raw transfer]




B60_A_3(3H2F)
?
[Raw transfer]




XHP_A_3(3TYB)
?
[Raw transfer]




XHP_B_12(3TYD)
?
[Raw transfer]




B61_B_8(3H2M)
?
[Raw transfer]




XHP_B_8(3TYE)
?
[Raw transfer]




B55_B_9(3H24)
?
[Raw transfer]




B62_B_8(3H2N)
?
[Raw transfer]




B62_A_3(3H2N)
?
[Raw transfer]




PT1_B_4(3TYU)
?
[Raw transfer]




B58_A_3(3H2C)
?
[Raw transfer]




XHP_B_8(3TYB)
?
[Raw transfer]




B58_B_9(3H2C)
?
[Raw transfer]




95 HHSearch 95.42100%-143 - C6 -2VP8 - DHPS2_MYCTU -
1 PsiBlast_PDB 95.2199%-143 - C6 -2VP8 - DHPS2_MYCTU -
21 PsiBlast_CBE 91.3699%-136 - C6 -2VP8 - DHPS2_MYCTU -
85 Fugue 73.2836%-102 - C6 -1AD1 - DHPS_STAAU -
65 PsiBlast_CBE 72.4037%-104 - C6 -1AD1 - DHPS_STAAU -
97 HHSearch 71.1830% -90 - C6 -2BMB 3.3 FOL1_YEAST
14 PsiBlast_PDB 70.9834% -96 - C6 -3H2E - ? -
103 HHSearch 70.4835%-104 * C6 *4HB7 - DHPS_STAAM -
2 PsiBlast_PDB 70.4534% -95 - C6 -1TWS - ? -
98 HHSearch 70.2334% -97 - C6 -4NIR - ? -
27 PsiBlast_CBE 70.2334%-107 - C6 -4NHV - ? -
6 PsiBlast_PDB 70.1034%-102 - C6 -1TX2 3.9 ?
52 PsiBlast_CBE 69.9634%-106 - C6 -3H2A 4.5 ?
26 PsiBlast_CBE 69.8934% -94 - C6 -4NIL - ? -
24 PsiBlast_CBE 69.8734% -97 - C6 -4NIR - ? -
41 PsiBlast_CBE 69.8434%-105 - C6 -3TYE 5.4 ?
69 PsiBlast_CBE 69.7833% -91 - C6 -3TZF 4.7 ?
25 PsiBlast_CBE 69.7334%-108 - C6 -4NIL - ? -
39 PsiBlast_CBE 69.7134%-111 - C6 -4D8A 3.9 ?
34 PsiBlast_CBE 69.6134%-115 - C6 -4DAF 3.1 ?
13 PsiBlast_PDB 69.5834%-106 - C6 -3H2C 4.2 ?
5 PsiBlast_PDB 69.5834%-105 - C6 -1TX0 5.1 ?
70 PsiBlast_CBE 69.5633% -88 - C6 -3TZF 4.8 ?
44 PsiBlast_CBE 69.5134%-102 - C6 -3TYD 5.4 ?
12 PsiBlast_PDB 69.5134%-108 - C6 -3H2A 4.3 ?
43 PsiBlast_CBE 69.4434%-106 - C6 -3TYD 5.4 ?
10 PsiBlast_PDB 69.4034%-100 - C6 -3H24 4.4 ?
16 PsiBlast_PDB 69.2834% -98 - C6 -3H2M 4.0 ?
40 PsiBlast_CBE 69.2334%-105 - C6 -4D8A 3.7 ?
15 PsiBlast_PDB 69.1534%-102 - C6 -3H2F 5.1 ?
42 PsiBlast_CBE 69.0934%-103 - C6 -3TYE 4.4 ?
55 PsiBlast_CBE 69.0534%-107 - C6 -1TX2 3.9 ?
7 PsiBlast_PDB 69.0534%-103 - C6 -3H21 3.0 ?
51 PsiBlast_CBE 69.0434%-109 - C6 -3H2C 4.5 ?
35 PsiBlast_CBE 68.9934%-107 - C6 -4D9P 3.6 ?
54 PsiBlast_CBE 68.9834%-107 - C6 -3H21 3.0 ?
29 PsiBlast_CBE 68.8234%-110 - C6 -4DB7 3.1 ?
37 PsiBlast_CBE 68.7934%-107 - C6 -4D8Z 5.6 ?
46 PsiBlast_CBE 68.7334%-102 - C6 -3TYB 5.3 ?
17 PsiBlast_PDB 68.7034%-105 - C6 -3H2N 4.6 ?
33 PsiBlast_CBE 68.6934%-112 - C6 -4DAF 3.1 ?
20 PsiBlast_PDB 68.5334%-105 - C6 -3TYB 5.5 ?
48 PsiBlast_CBE 68.3534%-103 - C6 -3H2N 2.3 ?
11 PsiBlast_PDB 68.2434%-100 - C6 -3H26 3.7 ?
45 PsiBlast_CBE 68.1334%-106 - C6 -3TYC 3.8 ?
32 PsiBlast_CBE 68.1234%-102 - C6 -4DAI 2.7 ?
100 HHSearch 68.1034% -95 - C6 -1AJ0 4.0 DHPS_ECOLI
8 PsiBlast_PDB 67.9034%-104 - C6 -3H22 4.4 ?
49 PsiBlast_CBE 67.7934%-104 - C6 -3H2M 3.0 ?
38 PsiBlast_CBE 67.7634%-106 - C6 -4D8Z 5.7 ?
72 PsiBlast_CBE 67.6933% -87 - C6 -3TYZ 3.9 ?
31 PsiBlast_CBE 67.6634%-108 - C6 -4DAI 3.4 ?
57 PsiBlast_CBE 67.6534%-103 - C6 -1TWZ 3.7 ?
56 PsiBlast_CBE 67.6034%-104 - C6 -1TX0 5.7 ?
47 PsiBlast_CBE 67.4734% -98 - C6 -3TYA 5.3 ?
71 PsiBlast_CBE 67.4533% -87 - C6 -3TYZ 5.5 ?
30 PsiBlast_CBE 67.4334%-106 - C6 -4DB7 3.0 ?
53 PsiBlast_CBE 67.2834%-105 - C6 -3H24 4.3 ?
67 PsiBlast_CBE 67.0834% -95 - C6 -1AJ2 4.3 DHPS_ECOLI
36 PsiBlast_CBE 66.9434%-103 - C6 -4D9P 4.3 ?
68 PsiBlast_CBE 66.2034% -92 - C6 -1AJ0 4.0 DHPS_ECOLI
101 HHSearch 64.7135%-100 - C6 -1EYE 3.8 DHPS1_MYCTU
18 PsiBlast_PDB 64.2934%-102 - C6 -3H2O 4.2 ?
99 HHSearch 64.0335%-100 - C6 -2Y5S 3.7 ?
84 PsiBlast_CBE 63.9035%-102 - C6 -1EYE 3.8 DHPS1_MYCTU
74 PsiBlast_CBE 63.4033% -91 - C6 -3TYU 5.3 ?
81 PsiBlast_CBE 63.0133%-105 - C6 -2VEG 3.2 DHPS_STRR6
78 PsiBlast_CBE 60.6235% -90 - C6 -2Y5S 4.2 ?
79 PsiBlast_CBE 60.5135% -88 - C6 -2Y5S 3.8 ?
73 PsiBlast_CBE 60.1733%-108 - C6 -3TYU 3.2 ?