@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : Rv1438: (2016-05-01 )
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGDKLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAATALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTGRVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGGASLDGEHFATLAAIAAGGPLP

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGH_A_3(3TAO)
TPIS_MYCTU
[Raw transfer]




G3P_B_5(3UWU)
TPIS_STAAR
[Raw transfer]




PGH_A_2(2VXN)
TPIS_LEIME
[Raw transfer]




PGA_C_3(1AMK)
TPIS_LEIME
[Raw transfer]




PGA_A_3(1BTM)
TPIS_GEOSE
[Raw transfer]




PGH_B_4(7TIM)
TPIS_YEAST
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_C_3(1QDS)
TPIS_LEIME
[Raw transfer]




PGA_A_3(2J27)
TPIS_TRYBB
[Raw transfer]




G2H_A_3(3UWZ)
TPIS_STAAR
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_B_4(2YPI)
TPIS_YEAST
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




13P_A_3(4YMZ)
?
[Raw transfer]




13P_B_14(4YMZ)
?
[Raw transfer]




PGA_B_4(1BTM)
TPIS_GEOSE
[Raw transfer]




13P_A_3(4YMZ)
?
[Raw transfer]




PGA_D_4(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_A_2(1N55)
TPIS_LEIME
[Raw transfer]




GOL_A_3(3GVG)
TPIS_MYCTU
[Raw transfer]




PGH_A_3(7TIM)
TPIS_YEAST
[Raw transfer]




129_C_3(1IF2)
TPIS_LEIME
[Raw transfer]




PGA_A_3(2YPI)
TPIS_YEAST
[Raw transfer]




129_C_3(1IF2)
TPIS_LEIME
[Raw transfer]




1GP_A_2(2Y61)
TPIS_LEIME
[Raw transfer]




G3P_A_2(2Y62)
TPIS_LEIME
[Raw transfer]




3PG_B_6(3UWW)
TPIS_STAAR
[Raw transfer]




BBR_A_2(2Y63)
TPIS_LEIME
[Raw transfer]




GOL_B_5(3GVG)
TPIS_MYCTU
[Raw transfer]




GOL_A_4(2VFE)
TPIS_PLAFA
[Raw transfer]




3PG_A_4(3UWW)
TPIS_STAAR
[Raw transfer]




GOL_B_6(2VFE)
TPIS_PLAFA
[Raw transfer]




G2H_B_5(3UWZ)
TPIS_STAAR
[Raw transfer]




2PG_B_7(3UWV)
TPIS_STAAR
[Raw transfer]




2PG_A_5(3UWV)
TPIS_STAAR
[Raw transfer]




UVW_A_4(4MVA)
?
[Raw transfer]




3PY_A_4(1O5X)
TPIS_PLAFA
[Raw transfer]




UVW_A_4(4MVA)
?
[Raw transfer]




EDO_B_16(4Z0J)
TPIS_PLAFA
[Raw transfer]




CIT_B_5(3M9Y)
TPIS_STAAR
[Raw transfer]




EDO_A_3(4Z0S)
TPIS_PLAFA
[Raw transfer]




PEG_B_9(4MVA)
?
[Raw transfer]




MRD_A_2(4MKN)
?
[Raw transfer]




MRD_A_2(4MKN)
?
[Raw transfer]




CIT_A_4(3UWU)
TPIS_STAAR
[Raw transfer]




2 PsiBlast_PDB 98.36100%-127 - C7 -3TAO 4.0 TPIS_MYCTU
21 PsiBlast_CBE 98.27100%-129 - C7 -3TAO - TPIS_MYCTU -
3 PsiBlast_PDB 97.8599%-128 - C7 -3GVG 2.3 TPIS_MYCTU
22 PsiBlast_CBE 97.73100%-129 - C7 -3TA6 - TPIS_MYCTU -
111 HHSearch 97.11100%-128 - C7 -3TA6 - TPIS_MYCTU -
1 PsiBlast_PDB 97.09100%-128 - C7 -3TA6 - TPIS_MYCTU -
23 PsiBlast_CBE 97.0899%-128 - C7 -3GVG 2.9 TPIS_MYCTU
120 HHSearch 83.1066%-121 - C7 -4Y9A - TPIS_STRCO -
4 PsiBlast_PDB 81.5767%-119 - C7 -4Y9A - TPIS_STRCO -
7 PsiBlast_PDB 80.7844%-117 - C7 -1B9B - PGKT_THEMA -
119 HHSearch 80.1744%-122 * C7 *1B9B - PGKT_THEMA -
29 PsiBlast_CBE 79.5844%-119 - C7 -1B9B - -
101 Fugue 78.2744%-108 - C7 -2BTM 4.0 TPIS_GEOSE
116 HHSearch 77.7045%-112 - C7 -2BTM 4.0 TPIS_GEOSE
14 PsiBlast_PDB 76.7345%-102 - C7 -2BTM 4.0 TPIS_GEOSE
24 PsiBlast_CBE 76.6349%-108 - C7 -1YYA - TPIS_THET8 -
114 HHSearch 76.6050%-108 - C7 -1YYA - TPIS_THET8 -
36 PsiBlast_CBE 76.4945%-106 - C7 -4Y96 - ? -
18 PsiBlast_PDB 76.4942%-113 - C7 -4Y8F - TPIS_CLOPE -
5 PsiBlast_PDB 76.3749%-107 - C7 -1YYA - TPIS_THET8 -
37 PsiBlast_CBE 75.2444%-102 - C7 -1BTM 3.2 TPIS_GEOSE
35 PsiBlast_CBE 75.1545%-102 - C7 -2BTM 3.1 TPIS_GEOSE
16 PsiBlast_PDB 74.9044%-101 - C7 -1BTM 3.3 TPIS_GEOSE
9 PsiBlast_PDB 74.5544%-105 - C7 -3UWU 2.9 TPIS_STAAR
11 PsiBlast_PDB 74.2744%-106 - C7 -3UWW 3.8 TPIS_STAAR
30 PsiBlast_CBE 74.0544%-106 - C7 -3M9Y 3.5 TPIS_STAAR
13 PsiBlast_PDB 73.9844%-104 - C7 -3UWZ 2.9 TPIS_STAAR
10 PsiBlast_PDB 73.9144%-105 - C7 -3UWV 2.3 TPIS_STAAR
77 PsiBlast_CBE 73.6541%-109 - C7 -4MKN 2.8 ?
34 PsiBlast_CBE 73.5544%-103 - C7 -3UWU 4.1 TPIS_STAAR
32 PsiBlast_CBE 72.9544%-102 - C7 -3UWW 3.3 TPIS_STAAR
33 PsiBlast_CBE 72.8844%-105 - C7 -3UWV 3.1 TPIS_STAAR
97 PsiBlast_CBE 72.0340%-101 - C7 -7TIM 3.6 TPIS_YEAST
31 PsiBlast_CBE 71.9944%-105 - C7 -3UWZ 3.4 TPIS_STAAR
72 PsiBlast_CBE 71.3039%-100 - C7 -4YMZ 3.7 ?
129 HHSearch 71.1439%-111 - C7 -4YMZ 3.7 ?
112 HHSearch 71.0041%-115 - C7 -4MVA 3.7 ?
102 Fugue 70.8140% -95 - C7 -1IF2 4.3 TPIS_LEIME
73 PsiBlast_CBE 70.7239%-101 - C7 -4YMZ 3.7 ?
131 HHSearch 70.3435%-105 - C7 -1O5X 3.2 TPIS_PLAFA
125 HHSearch 70.1840%-104 - C7 -4MKN 2.8 ?
100 PsiBlast_CBE 69.9040%-100 - C7 -2YPI 3.7 TPIS_YEAST
83 PsiBlast_CBE 69.6141% -94 - C7 -2Y62 3.7 TPIS_LEIME
99 PsiBlast_CBE 69.4640% -99 - C7 -2YPI 3.8 TPIS_YEAST
82 PsiBlast_CBE 69.2941% -93 - C7 -2Y63 3.1 TPIS_LEIME
86 PsiBlast_CBE 69.2241% -92 - C7 -1QDS 4.1 TPIS_LEIME
84 PsiBlast_CBE 68.9141% -91 - C7 -2Y61 3.8 TPIS_LEIME
85 PsiBlast_CBE 68.8441% -93 - C7 -2VXN 4.3 TPIS_LEIME
87 PsiBlast_CBE 68.8341% -94 - C7 -1N55 3.4 TPIS_LEIME
124 HHSearch 68.7438%-100 - C7 -2J27 2.8 TPIS_TRYBB
98 PsiBlast_CBE 68.6040% -97 - C7 -7TIM 3.9 TPIS_YEAST
88 PsiBlast_CBE 68.5941% -91 - C7 -1IF2 4.3 TPIS_LEIME
45 PsiBlast_CBE 68.5142%-107 - C7 -4MVA 3.7 ?
44 PsiBlast_CBE 68.0342%-109 - C7 -4MVA 2.0 ?
92 PsiBlast_CBE 67.4835% -96 - C7 -2VFE 2.5 TPIS_PLAFA
95 PsiBlast_CBE 66.4540% -87 - C7 -1AMK 4.2 TPIS_LEIME
91 PsiBlast_CBE 66.2935% -99 - C7 -2VFE 2.2 TPIS_PLAFA
96 PsiBlast_CBE 64.4335% -94 - C7 -4Z0S 2.7 TPIS_PLAFA
80 PsiBlast_CBE 63.7035% -94 - C7 -4Z0J 2.7 TPIS_PLAFA